Protein Info for H281DRAFT_05324 in Paraburkholderia bryophila 376MFSha3.1

Annotation: tripartite ATP-independent transporter solute receptor, DctP family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 331 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details PF03480: DctP" amino acids 35 to 316 (282 residues), 287.9 bits, see alignment E=4.4e-90 TIGR00787: TRAP transporter solute receptor, DctP family" amino acids 39 to 284 (246 residues), 217.2 bits, see alignment E=1.3e-68

Best Hits

Swiss-Prot: 80% identical to DCTP_BURCM: Solute-binding protein Bamb_6123 (Bamb_6123) from Burkholderia ambifaria (strain ATCC BAA-244 / AMMD)

KEGG orthology group: None (inferred from 97% identity to bug:BC1001_5602)

Predicted SEED Role

"TRAP-type C4-dicarboxylate transport system, periplasmic component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MMW2 at UniProt or InterPro

Protein Sequence (331 amino acids)

>H281DRAFT_05324 tripartite ATP-independent transporter solute receptor, DctP family (Paraburkholderia bryophila 376MFSha3.1)
MMNKKFASSRVSLIVAASVLAFGAMSAQARVFRVSDVHGDTYPTNMAVKYMGEQIKTATG
GKDSVKVFGNSALGSENDTIDQVRIGALDMARANGAAFNEIVPESMIPSLPFLFRDIDHF
RKVMYGPEGQKILDAFKAKGMIALTFYESGARSIYTKKPIRTPADMKGLKVRVQPSDLMV
DEIRAMGGTPTPMPFAEVYTGLKTGLVDAAENNLPSYEETKHFEVAPVYSETQHSMTPEV
LVFSKKVWDTLSPQEQEIIKKAAADSVPYYQKLWTARENDASKTVTKGGAQIVASSQIDR
AAFVKVMQPVWAKYEKTPQMKQLVDEIQAIK