Protein Info for H281DRAFT_05296 in Paraburkholderia bryophila 376MFSha3.1

Annotation: GntR family transcriptional regulator, histidine utilization repressor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 276 TIGR02018: histidine utilization repressor" amino acids 41 to 269 (229 residues), 275.9 bits, see alignment E=1.2e-86 PF00392: GntR" amino acids 42 to 104 (63 residues), 69.7 bits, see alignment E=1.9e-23 PF08220: HTH_DeoR" amino acids 69 to 99 (31 residues), 22.3 bits, see alignment 1.4e-08 PF07702: UTRA" amino acids 125 to 262 (138 residues), 111.6 bits, see alignment E=4.2e-36

Best Hits

Swiss-Prot: 50% identical to HUTC_PSEAE: Histidine utilization repressor (hutC) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K05836, GntR family transcriptional regulator, histidine utilization repressor (inferred from 86% identity to bug:BC1001_5575)

Predicted SEED Role

"Histidine utilization repressor" in subsystem Histidine Degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MH72 at UniProt or InterPro

Protein Sequence (276 amino acids)

>H281DRAFT_05296 GntR family transcriptional regulator, histidine utilization repressor (Paraburkholderia bryophila 376MFSha3.1)
MSSMLRGKSHKTHGKPPAAAAQSTRDATAGTSAAGEAPAARYEQVKQHILGIIESGARQA
GERLPSELDLVATLGVSRMTVNRALRELAHEGLVTRVSGVGTFVAQARPQSTLLMIAHIG
DEIRSRGHEYSYRTVLLQRETASVVVSNALGLAPAASVFHVVCVHRENGLPVQLEDRYVN
PAIAPDFLQQDFSSIRPSEYLFETVPAHDVEHIVDAGLPTQAEAGLLEIRAEEPCLTLVR
RTWTSGVAVTFARFVHPGSRYRLGCRFSPDMSQRQG