Protein Info for H281DRAFT_05280 in Paraburkholderia bryophila 376MFSha3.1

Annotation: malonate decarboxylase delta subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03130: malonate decarboxylase acyl carrier protein
  • amino acids 2 to 97 (96 residues), 113.8 bits, E=1.4e-37
• PF06857: ACP
  • amino acids 16 to 98 (83 residues), 77.3 bits, E=4.4e-26

Best Hits

Swiss-Prot: 52% identical to MDCC_PSEAB: Malonate decarboxylase acyl carrier protein (mdcC) from Pseudomonas aeruginosa (strain UCBPP-PA14)

KEGG orthology group: K13931, malonate decarboxylase delta subunit (inferred from 93% identity to bug:BC1001_5559)

MetaCyc: 40% identical to malonate decarboxylase acyl-carrier protein subunit (Malonomonas rubra)
RXN-9774 [EC: 7.2.4.4]

Predicted SEED Role

"Malonate decarboxylase delta subunit" in subsystem Malonate decarboxylase

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.2.4.4

Sequence Analysis Tools

See A0A2Z5MHB9 at UniProt or InterPro

Protein Sequence (104 amino acids)

>H281DRAFT_05280 malonate decarboxylase delta subunit (Paraburkholderia bryophila 376MFSha3.1)
MEHLTFDYPAQRAVTTRAHVGVVGSGDLEVLLAPVDNANALTAHVVVRTSVDGYSHIWKS
VLDRFFTRYDGAAQIEINDFGATPGVVALRLAEAVEAAEQGDDA