Protein Info for H281DRAFT_05246 in Paraburkholderia bryophila 376MFSha3.1

Annotation: Predicted membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 164 transmembrane" amino acids 20 to 37 (18 residues), see Phobius details amino acids 49 to 66 (18 residues), see Phobius details amino acids 72 to 93 (22 residues), see Phobius details PF20730: YetF_N" amino acids 18 to 81 (64 residues), 26.6 bits, see alignment E=4.3e-10 PF04239: DUF421" amino acids 94 to 164 (71 residues), 41.9 bits, see alignment E=7.3e-15

Best Hits

KEGG orthology group: None (inferred from 85% identity to bgf:BC1003_1837)

Predicted SEED Role

"FIG028593: membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MAV8 at UniProt or InterPro

Protein Sequence (164 amino acids)

>H281DRAFT_05246 Predicted membrane protein (Paraburkholderia bryophila 376MFSha3.1)
MMDAIYLLFGQGRDLDPLQMSLRAFVVFVVTLVLIRISGRRSFGKRSPFDSVVVILLGAT
LGRAIVGASPFVATVLASLMIVVCHRVLAWACVRSSAIERLIGGVEREVYHNGAFNEREM
KAALMTRNDVCESVRQKTGSRSMDKVAAAILERNGDVSVIHKDQ