Protein Info for H281DRAFT_05188 in Paraburkholderia bryophila 376MFSha3.1

Annotation: Pimeloyl-ACP methyl ester carboxylesterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 340 PF12146: Hydrolase_4" amino acids 69 to 305 (237 residues), 52.5 bits, see alignment E=6.8e-18 PF00561: Abhydrolase_1" amino acids 70 to 307 (238 residues), 91.8 bits, see alignment E=8.3e-30 PF12697: Abhydrolase_6" amino acids 71 to 311 (241 residues), 83.2 bits, see alignment E=6.6e-27

Best Hits

KEGG orthology group: None (inferred from 84% identity to bgf:BC1003_1896)

Predicted SEED Role

"3-oxoadipate enol-lactone hydrolase/4-carboxymuconolactone decarboxylase" in subsystem Protocatechuate branch of beta-ketoadipate pathway

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (340 amino acids)

>H281DRAFT_05188 Pimeloyl-ACP methyl ester carboxylesterase (Paraburkholderia bryophila 376MFSha3.1)
MASREPRSSASSSTRPSNSAALPPRSLAARLGITSVPRDELRRRYTQSGSRFVRIMGADV
HYVDEGSGGTIVMIHGFASSLHTWNRVADELKHAHRVIRLDLPPFGVTGPLRSSTGVIET
MNLPTYRRFIDTFLQALGVSRAIFIGNSLGGLIAWDYAVRHRDAVERLVLIDSAGFPMKL
PIYIDLFNHALVRASSPRWLPEIIIKSAVRNVYGDPRRLDAVTLRRYVDFFHGEGTRAAI
GKMVPTLDFEELDTDVLTTLAVPTLVLWGAKDRWIPTAHAAEFARRIPGAKSVMYPGLGH
IPMEEAPERVLADLRAFLGGNASNSEELLLREEGSRRASV