Protein Info for H281DRAFT_05183 in Paraburkholderia bryophila 376MFSha3.1

Annotation: putrescine transport system permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 271 transmembrane" amino acids 9 to 31 (23 residues), see Phobius details amino acids 61 to 86 (26 residues), see Phobius details amino acids 99 to 122 (24 residues), see Phobius details amino acids 135 to 155 (21 residues), see Phobius details amino acids 180 to 202 (23 residues), see Phobius details amino acids 239 to 260 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 79 to 266 (188 residues), 58.8 bits, see alignment E=3.2e-20

Best Hits

Swiss-Prot: 57% identical to POTI_ECOL6: Putrescine transport system permease protein PotI (potI) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K11074, putrescine transport system permease protein (inferred from 97% identity to bgf:BC1003_1899)

MetaCyc: 57% identical to putrescine ABC transporter membrane subunit PotI (Escherichia coli K-12 substr. MG1655)
ABC-25-RXN [EC: 7.6.2.11, 7.6.2.16]

Predicted SEED Role

"Putrescine transport system permease protein PotI (TC 3.A.1.11.2)" in subsystem Polyamine Metabolism (TC 3.A.1.11.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.11 or 7.6.2.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MD03 at UniProt or InterPro

Protein Sequence (271 amino acids)

>H281DRAFT_05183 putrescine transport system permease protein (Paraburkholderia bryophila 376MFSha3.1)
MKPNRILQFTALALGFLFLYVPIVSLIVYSFNESQLVTVWTRFSTRWYAALLQDDELIAA
AWLSLRVAVLTAFASVIIGTWAGFVLARMGRFRGFTLYTGMINAPLVIPEVIQGISLLLL
FIEMAKWLGWPAGRGIFTIWIGHVMLCISYVAIIVQSRVKELHPSLEEAALDLGATPLRV
FFSITLPLISQALVSGWLLSFTLSIDDLVLSAFLSGPGSTTLPLVVFSRVRLGLNPEMNA
LATLFIAVVTVGVVAVNYFMQRAERRRVQVA