Protein Info for H281DRAFT_05176 in Paraburkholderia bryophila 376MFSha3.1
Annotation: hypothetical protein
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
KEGG orthology group: K06938, (no description) (inferred from 94% identity to bpy:Bphyt_2312)Predicted SEED Role
"Phosphoenolpyruvate synthase (EC 2.7.9.2)" in subsystem Glycolysis and Gluconeogenesis or Glycolysis and Gluconeogenesis, including Archaeal enzymes or Pyruvate metabolism I: anaplerotic reactions, PEP (EC 2.7.9.2)
MetaCyc Pathways
- superpathway of glycolysis and the Entner-Doudoroff pathway (15/17 steps found)
- gluconeogenesis I (12/13 steps found)
- superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (21/26 steps found)
- glycolysis II (from fructose 6-phosphate) (10/11 steps found)
- glycolysis I (from glucose 6-phosphate) (11/13 steps found)
- hexitol fermentation to lactate, formate, ethanol and acetate (15/19 steps found)
- superpathway of anaerobic sucrose degradation (15/19 steps found)
- superpathway of N-acetylneuraminate degradation (16/22 steps found)
- glycolysis V (Pyrococcus) (7/10 steps found)
- superpathway of hexitol degradation (bacteria) (12/18 steps found)
- gluconeogenesis II (Methanobacterium thermoautotrophicum) (11/18 steps found)
- Methanobacterium thermoautotrophicum biosynthetic metabolism (24/56 steps found)
KEGG Metabolic Maps
Isozymes
Compare fitness of predicted isozymes for: 2.7.9.2
Use Curated BLAST to search for 2.7.9.2
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A2Z5MBS2 at UniProt or InterPro
Protein Sequence (67 amino acids)
>H281DRAFT_05176 hypothetical protein (Paraburkholderia bryophila 376MFSha3.1) MASNLHALPDSPCIGVCSTLFDDICKGCGRTAGEVSNWVFLSDEEKRAVWVRIEQEGTAM RFQNDKL