Protein Info for H281DRAFT_05160 in Paraburkholderia bryophila 376MFSha3.1

Annotation: allantoicase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 337 TIGR02961: allantoicase" amino acids 17 to 333 (317 residues), 476.5 bits, see alignment E=1.5e-147 PF03561: Allantoicase" amino acids 26 to 172 (147 residues), 180 bits, see alignment E=1.3e-57 amino acids 193 to 335 (143 residues), 161.3 bits, see alignment E=8.1e-52

Best Hits

Swiss-Prot: 88% identical to ALLC1_BURPS: Probable allantoicase 1 (alc1) from Burkholderia pseudomallei (strain K96243)

KEGG orthology group: K01477, allantoicase [EC: 3.5.3.4] (inferred from 98% identity to bug:BC1001_1456)

Predicted SEED Role

"Allantoicase (EC 3.5.3.4)" in subsystem Allantoin Utilization (EC 3.5.3.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.3.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MBV1 at UniProt or InterPro

Protein Sequence (337 amino acids)

>H281DRAFT_05160 allantoicase (Paraburkholderia bryophila 376MFSha3.1)
MALPILDPNAPEFTRRYVNLADPRLGAQALEASDDFFAPKERMLNPEPAVFIPGKYDEHG
KWMDGWETRRKRVSGYDWCIVKLARPGVIKGLDLDTSHFTGNFPPAASVEAARVVDGVPN
QSTQWTEIVPSTTLQGNSHHYLDVSDANAYTHLRVNIYPDGGIARLRVYGQPQVDWAGAS
RTEQFDLAAMENGAYLVAANNQHFGAASTILMPGRGVNMGDGWETRRRREPGNDWAIVAL
AQPGVISKIEVDTAHFKGNYPDRCSIQAAYVTGGTDSSLITQAMFWPVLLGEQKLQMDKQ
HYFESEIAALGPVTHVRFNIIPDGGVSRLRLWGTLAS