Protein Info for H281DRAFT_05159 in Paraburkholderia bryophila 376MFSha3.1

Annotation: 2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF09349: OHCU_decarbox
  • amino acids 12 to 168 (157 residues), 185.8 bits, E=3.8e-59
• TIGR03164: OHCU decarboxylase
  • amino acids 15 to 170 (156 residues), 229.8 bits, E=8.2e-73

Best Hits

Swiss-Prot: 44% identical to URAD_HALVD: 2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase (HVO_B0301) from Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2)

KEGG orthology group: None (inferred from 95% identity to bgf:BC1003_1928)

Predicted SEED Role

"Urate oxidase (EC 1.7.3.3)" (EC 1.7.3.3)

MetaCyc Pathways

• superpathway of purines degradation in plants (14/18 steps found)
• ureide biosynthesis (5/7 steps found)
• urate conversion to allantoin I (2/3 steps found)

KEGG Metabolic Maps

• Caffeine metabolism
• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.7.3.3

Use Curated BLAST to search for 1.7.3.3

Sequence Analysis Tools

See A0A2Z5MCJ1 at UniProt or InterPro

Protein Sequence (173 amino acids)

>H281DRAFT_05159 2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase (Paraburkholderia bryophila 376MFSha3.1)
MKAMQYTLDQLNTVSTDAFVAALSGIFEHSPWVAEIAAHERPFASIDELHRKMSKIVETA
GEEKQLALINAHPELAGKAAVRGELTAESTREQSGAGLSQCTQEEFDKLLALNAAYREKF
GFPFILAVRGYDRHGIIANFEARVNNSRADELRASLDQIYRIARFRLEDLIGA