Protein Info for H281DRAFT_05154 in Paraburkholderia bryophila 376MFSha3.1

Annotation: murein tetrapeptidase LD-carboxypeptidase (EC:3.4.17.13). Serine peptidase. MEROPS family S66

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 308 PF02016: Peptidase_S66" amino acids 9 to 130 (122 residues), 84.9 bits, see alignment E=4.9e-28 PF17676: Peptidase_S66C" amino acids 174 to 290 (117 residues), 108.9 bits, see alignment E=2.6e-35

Best Hits

KEGG orthology group: K01297, muramoyltetrapeptide carboxypeptidase [EC: 3.4.17.13] (inferred from 89% identity to bgf:BC1003_1933)

Predicted SEED Role

"Muramoyltetrapeptide carboxypeptidase (EC 3.4.17.13)" (EC 3.4.17.13)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 3.4.17.13

Use Curated BLAST to search for 3.4.17.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MBN7 at UniProt or InterPro

Protein Sequence (308 amino acids)

>H281DRAFT_05154 murein tetrapeptidase LD-carboxypeptidase (EC:3.4.17.13). Serine peptidase. MEROPS family S66 (Paraburkholderia bryophila 376MFSha3.1)
MSVHRTFNLIAPSGYPQEADVLNRALQRLRAQGHRVEGVDATRRRYQRFGGTDGERAADL
NRLADASRALPDIVLAVRGGYGAARILHGLDYDGLQRRLSGEPVALVGHSDFTAIQLALL
ARAGLKTFSGPMLMSDFGAEHVSDFTMQHFWSALTKPTLTIARNVPQAHAVDVSGTFWGG
NLAVLTSLVGTPYIPSVQGGVLFVEDVNEQPFRIERMLYQLHLSGILGEQQALVLGDFSG
GKSYDYDNGYDLQAMIDQMRSVIGIPIVTGLQFGHVPDMLTLPVGADAHLVADANGFKLT
LTDYPCLR