Protein Info for H281DRAFT_05143 in Paraburkholderia bryophila 376MFSha3.1

Annotation: Predicted membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 280 transmembrane" amino acids 6 to 23 (18 residues), see Phobius details amino acids 30 to 51 (22 residues), see Phobius details amino acids 57 to 77 (21 residues), see Phobius details amino acids 89 to 108 (20 residues), see Phobius details amino acids 114 to 133 (20 residues), see Phobius details amino acids 140 to 158 (19 residues), see Phobius details amino acids 170 to 194 (25 residues), see Phobius details amino acids 206 to 229 (24 residues), see Phobius details amino acids 237 to 256 (20 residues), see Phobius details PF00892: EamA" amino acids 140 to 278 (139 residues), 32.8 bits, see alignment E=3.7e-12

Best Hits

KEGG orthology group: None (inferred from 89% identity to bug:BC1001_1441)

Predicted SEED Role

"Permeases of the drug/metabolite transporter (DMT) superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (280 amino acids)

>H281DRAFT_05143 Predicted membrane protein (Paraburkholderia bryophila 376MFSha3.1)
MLSYTGGLVLFAALLHASWNALLHGNRDRFLSMTWISIAIAAIATLIIPFTPLPAAAAWP
YIVASGLVHIGYNASLVRAYRRGDLAQAYPIARGSSPLLVTLGAALFAHEAIGPLRAIGI
VMISGGIIAIALEAGSVSRAGVLAALTTGATIALYTVIDGIGVRLSGGEALAYTAWMFLF
YWLMPVLFVAMRGVSALWTPIRSTPMAVGSSLMGGVVSVAAYGIVIWAMQSGAMGTVSAL
RETSVVFAVLIGRMFLGEAVSGKRWLACMVVAAGAICLGL