Protein Info for H281DRAFT_05115 in Paraburkholderia bryophila 376MFSha3.1

Annotation: dihydrolipoamide dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01350: dihydrolipoyl dehydrogenase
  • amino acids 4 to 476 (473 residues), 571.1 bits, E=8.2e-176
• PF07992: Pyr_redox_2
  • amino acids 5 to 338 (334 residues), 260.7 bits, E=1.1e-80
• PF03486: HI0933_like
  • amino acids 5 to 47 (43 residues), 26.1 bits, 2.1e-09
• PF01134: GIDA
  • amino acids 6 to 156 (151 residues), 25.4 bits, E=4.3e-09
• PF12831: FAD_oxidored
  • amino acids 6 to 55 (50 residues), 29.6 bits, 2.9e-10
• PF00890: FAD_binding_2
  • amino acids 6 to 43 (38 residues), 29.1 bits, 3.7e-10
• PF13738: Pyr_redox_3
  • amino acids 141 to 322 (182 residues), 39.3 bits, E=3e-13
• PF00070: Pyr_redox
  • amino acids 186 to 260 (75 residues), 64.1 bits, E=8.6e-21
• PF02737: 3HCDH_N
  • amino acids 186 to 241 (56 residues), 22.2 bits, 7.2e-08
• PF02852: Pyr_redox_dim
  • amino acids 357 to 466 (110 residues), 131.8 bits, E=7.5e-42

Best Hits

Swiss-Prot: 78% identical to DLDH_CUPNH: Dihydrolipoyl dehydrogenase (odhL) from Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337)

KEGG orthology group: K00382, dihydrolipoamide dehydrogenase [EC: 1.8.1.4] (inferred from 98% identity to bug:BC1001_1392)

MetaCyc: 50% identical to dihydrolipoyl dehydrogenase subunit (Syntrophotalea carbinolica DSM 2380)

Predicted SEED Role

"Dihydrolipoamide dehydrogenase of 2-oxoglutarate dehydrogenase (EC 1.8.1.4)" in subsystem TCA Cycle (EC 1.8.1.4)

MetaCyc Pathways

• 2-oxoglutarate decarboxylation to succinyl-CoA (3/3 steps found)
• glycine biosynthesis II (3/3 steps found)
• glycine cleavage (3/3 steps found)
• pyruvate decarboxylation to acetyl CoA I (3/3 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (16/22 steps found)
• 2-oxoisovalerate decarboxylation to isobutanoyl-CoA (1/3 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Citrate cycle (TCA cycle)
• Glycine, serine and threonine metabolism
• Glycolysis / Gluconeogenesis
• Pyruvate metabolism
• Valine, leucine and isoleucine degradation

Isozymes

Compare fitness of predicted isozymes for: 1.8.1.4

Use Curated BLAST to search for 1.8.1.4

Sequence Analysis Tools

See A0A2Z5MFJ8 at UniProt or InterPro

Protein Sequence (476 amino acids)

>H281DRAFT_05115 dihydrolipoamide dehydrogenase (Paraburkholderia bryophila 376MFSha3.1)
MSKEFDVVVIGAGPGGYIAAIRAAQLGKTVACIEKWKNPAGTLKLGGTCLNVGCIPSKAL
LASSEEFENASHHLADHGISVENVKVDISKMMARKDGIVEKMTKGIEFLFRKNKITWLKG
HGKFTGKTDAGVQIEVSGEGETEVVTAKNVIIATGSKARHLPNIPVDNKIVADNEGALAF
DTAPKKLAVIGAGVIGLELGSVWRRLGAEVTVLEALPEFLGAADQALAKEAAKQFKKQGL
DIHVGVKVGEVSTTENSVTINYTDKDGNAQKLEADRLIVSIGRVPNTDNLGLEAIGLKAN
ERGFIDVDDHCATAVPNVYAIGDVVRGPMLAHKAEDEGVLVAEIIDGQKPHIDYNCIPWV
IYTEPEIAWVGKTEQQLKAEGREVKTGQFPFMANGRALGINKADGFVKMIADAKTDELLG
VHIISANASDLIAEAVVAMEFKAASEDIGRICHPHPSLSEVMREAALAVDKRALNM