Protein Info for H281DRAFT_05103 in Paraburkholderia bryophila 376MFSha3.1

Annotation: NusA antitermination factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 491 PF08529: NusA_N" amino acids 4 to 127 (124 residues), 131.8 bits, see alignment E=2.9e-42 TIGR01953: transcription termination factor NusA" amino acids 5 to 344 (340 residues), 408.6 bits, see alignment E=1.9e-126 PF00575: S1" amino acids 140 to 198 (59 residues), 34.9 bits, see alignment 3.4e-12 PF13184: KH_5" amino acids 232 to 299 (68 residues), 87.9 bits, see alignment E=7.6e-29 TIGR01954: transcription termination factor NusA, C-terminal duplication" amino acids 367 to 416 (50 residues), 64.1 bits, see alignment 9.4e-22 amino acids 440 to 489 (50 residues), 59.2 bits, see alignment 3.3e-20 PF14520: HHH_5" amino acids 432 to 487 (56 residues), 31.9 bits, see alignment 3e-11

Best Hits

Swiss-Prot: 52% identical to NUSA_COXBU: Transcription termination/antitermination protein NusA (nusA) from Coxiella burnetii (strain RSA 493 / Nine Mile phase I)

KEGG orthology group: K02600, N utilization substance protein A (inferred from 99% identity to bge:BC1002_1188)

Predicted SEED Role

"Transcription termination protein NusA" in subsystem NusA-TFII Cluster or Transcription factors bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MBT4 at UniProt or InterPro

Protein Sequence (491 amino acids)

>H281DRAFT_05103 NusA antitermination factor (Paraburkholderia bryophila 376MFSha3.1)
MSREVLMLVDALAREKNVDKDVVFAALEAALASASKKLFDEDADIRVHIDRESGEHETFR
RWKVVPDEAGLQEPDQEILLFEAREQKPEIQLDEYIEEPVPSIEFGRIGAQAAKQVILQK
VRDAEREQILNDFLERGEHIMTGSVKRLDKGNFIVETGRVEALLRRDQLIPKENLRVGDR
VRAYIAKVDRTARGPQIELSRTAPEFLMKLFEMEVPEIEQGLLEIKAAARDPGVRAKIGV
VAYDKRIDPIGTCVGIRGSRVQAVRNELGGENVDIVLWSEDPAQFVIGALAPAAVQSIVV
DEEKHSMDVVVDENELAVAIGRSGQNVRLASELTGWQINIMTPDESAQKQNQERGVLRDL
FMARLDVDEEVADILIDEGFTSLEEIAYVPLNEMLEIEAFDEDTVHELRNRSRDALLTMA
IANEEKVENVALDLKSLDGMDADLLAKLAEHQIQTRDELAELAVDELVEMTGMEEDAAKA
LIMKAREHWFQ