Protein Info for H281DRAFT_05102 in Paraburkholderia bryophila 376MFSha3.1

Annotation: ribosome maturation factor RimP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 152 PF02576: RimP_N" amino acids 6 to 73 (68 residues), 61.4 bits, see alignment E=9.4e-21 PF17384: DUF150_C" amino acids 76 to 144 (69 residues), 65.8 bits, see alignment E=3.3e-22

Best Hits

Swiss-Prot: 99% identical to RIMP_PARXL: Ribosome maturation factor RimP (rimP) from Paraburkholderia xenovorans (strain LB400)

KEGG orthology group: K09748, ribosome maturation factor RimP (inferred from 97% identity to bph:Bphy_1731)

Predicted SEED Role

"FIG000325: clustered with transcription termination protein NusA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MB96 at UniProt or InterPro

Protein Sequence (152 amino acids)

>H281DRAFT_05102 ribosome maturation factor RimP (Paraburkholderia bryophila 376MFSha3.1)
VQLTELIETTVVGLGYELVDLERTGRGMLCIYIDQPAGIAIEDCEKVTRQLQHVLTVENI
DYERLEVSSPGLDRPLKKLADFERFAGSEVVITLKKPLDGRKSYRGILHAPQGETIGLEF
EGKEGAAMLDFTLADMDKARLVPKVDFRSRKQ