Protein Info for H281DRAFT_05070 in Paraburkholderia bryophila 376MFSha3.1

Annotation: camphor resistance protein CrcB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 144 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details amino acids 52 to 73 (22 residues), see Phobius details amino acids 84 to 102 (19 residues), see Phobius details amino acids 121 to 142 (22 residues), see Phobius details TIGR00494: protein CrcB" amino acids 24 to 136 (113 residues), 97 bits, see alignment E=4.5e-32 PF02537: CRCB" amino acids 24 to 136 (113 residues), 94.4 bits, see alignment E=2.5e-31

Best Hits

Swiss-Prot: 90% identical to CRCB_PARXL: Putative fluoride ion transporter CrcB (crcB) from Paraburkholderia xenovorans (strain LB400)

KEGG orthology group: K06199, CrcB protein (inferred from 91% identity to bgf:BC1003_2029)

Predicted SEED Role

"Integral membrane protein possibly involved in chromosome condensation"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (144 amino acids)

>H281DRAFT_05070 camphor resistance protein CrcB (Paraburkholderia bryophila 376MFSha3.1)
MASRSARFVESHVSPGTLMYWSILAVAVGGALGSLFRWFLGLRLNALFPSLPLGTFASNV
IAGYIIGVAVAGFARAPQIAPEWRLFVITGMMGGLSTFSTFSAEVVQHLQDGRLGWAAGE
VAIHVGASLVMTILGIATVTLLSR