Protein Info for H281DRAFT_05043 in Paraburkholderia bryophila 376MFSha3.1

Annotation: RNA polymerase sigma-70 factor, ECF subfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 170 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 12 to 158 (147 residues), 73.9 bits, see alignment E=5.9e-25 PF04542: Sigma70_r2" amino acids 14 to 75 (62 residues), 41.8 bits, see alignment E=1.1e-14 PF08281: Sigma70_r4_2" amino acids 106 to 157 (52 residues), 60.2 bits, see alignment E=1.8e-20 PF04545: Sigma70_r4" amino acids 112 to 156 (45 residues), 30 bits, see alignment E=4.6e-11

Best Hits

KEGG orthology group: None (inferred from 62% identity to bgf:BC1003_4181)

Predicted SEED Role

"RNA polymerase sigma-54 factor RpoN" in subsystem Flagellar motility or Flagellum or Transcription initiation, bacterial sigma factors

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (170 amino acids)

>H281DRAFT_05043 RNA polymerase sigma-70 factor, ECF subfamily (Paraburkholderia bryophila 376MFSha3.1)
MKQTDLSLLLPDMLPRLWSFAFRLSRNRYDAEELVQRACIRGLERAHQLRAGTSALNWMF
SIVHSTWLNDLKQRDQRSQLQAEWSDTLSETVADPGSASEAGALAQQIIAAVERLPEAQR
VVLLLVSVEGFGYQEAADALQIPVGTVMSRLSRARRTIGALFDDDCKTAR