Protein Info for H281DRAFT_05040 in Paraburkholderia bryophila 376MFSha3.1

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 281 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 34 to 59 (26 residues), see Phobius details amino acids 69 to 88 (20 residues), see Phobius details amino acids 109 to 130 (22 residues), see Phobius details amino acids 138 to 161 (24 residues), see Phobius details amino acids 174 to 194 (21 residues), see Phobius details amino acids 212 to 229 (18 residues), see Phobius details amino acids 233 to 250 (18 residues), see Phobius details amino acids 257 to 278 (22 residues), see Phobius details PF02517: Rce1-like" amino acids 174 to 268 (95 residues), 56.9 bits, see alignment E=1e-19

Best Hits

KEGG orthology group: K07052, (no description) (inferred from 71% identity to bug:BC1001_1209)

Predicted SEED Role

"CAAX amino terminal protease family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (281 amino acids)

>H281DRAFT_05040 hypothetical protein (Paraburkholderia bryophila 376MFSha3.1)
MAALPWIAIFIAASTAIFRAPRRLTLVLLAIGYGLAFALGQLHVLAILPIALLLCTGILL
QWNPSPLGKLLCNVVFVIVALGLFQHWLPGFQNLKVIDAARFTPDAAPYTMYLNFDKPLI
GFWLVLTYPWVQPKKSFPVVAVSALGACALTSAVCLFIAFEAGSIAWAPKWPHLAWLWML
NNFLFVAFAEEAFFRGYIQAGITRLMKARPQAWWFGLIVAAVLFGLAHYQGGTALVVLAG
LSGLGYGLAYRAGGLQAAMLTHFGLNLVQFGLFTYPFIARS