Protein Info for H281DRAFT_05007 in Paraburkholderia bryophila 376MFSha3.1

Annotation: type III secretion protein V

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 702 transmembrane" amino acids 7 to 31 (25 residues), see Phobius details amino acids 33 to 56 (24 residues), see Phobius details amino acids 63 to 83 (21 residues), see Phobius details amino acids 105 to 127 (23 residues), see Phobius details amino acids 195 to 216 (22 residues), see Phobius details amino acids 236 to 255 (20 residues), see Phobius details amino acids 276 to 295 (20 residues), see Phobius details amino acids 301 to 318 (18 residues), see Phobius details TIGR01399: type III secretion protein, HrcV family" amino acids 12 to 700 (689 residues), 846.8 bits, see alignment E=6.8e-259 PF00771: FHIPEP" amino acids 22 to 689 (668 residues), 660.6 bits, see alignment E=1.4e-202

Best Hits

KEGG orthology group: K03230, type III secretion protein SctV (inferred from 74% identity to bug:BC1001_6053)

Predicted SEED Role

"Type III secretion inner membrane channel protein (LcrD,HrcV,EscV,SsaV)" in subsystem Type III secretion systems, extended

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MDC5 at UniProt or InterPro

Protein Sequence (702 amino acids)

>H281DRAFT_05007 type III secretion protein V (Paraburkholderia bryophila 376MFSha3.1)
MLKTLKLPVGGEIGMLFLIIAILSLMILPLPTFMIDILVGLNIAASVTLLMITLYVPSVV
SLSAFPSLLLFTTLYRLSLSIASTKSILLHAEAGEIIDSFGKLVVGGNLVVGMVVFIIIT
LVQFIVIAKGSERVAEVGARFTLDAMPGKQMSIDADLRANLLTSDEARHKRATLALESAL
HGGMDGAMKFVKGDAVAGLIITVINIVAGLAVGVAYHGMTAAEAANRFSILSVGDAMVAQ
VPALLLSVAAGVMITRVADDRDETQRSLGADIGRQLITSPPALFFAAVLLLAFAAVPGFP
WLLFILLSGVLAFAAYRLQKSKPSRQLHDGESVRSMQRVGAKIETPAIATHPPAFTCALG
VRIAPDLVARLSLAGLNTSFEAEREVLQEELGLPFPGITMWTSDRLAASTCEFLMHDVPY
LTVEIPPGKVVLPTLPLALAREASGIGEDRPGDAELRALAPNCEQRAPLDGSSQPSYWHD
EKGLPAKTEAWRAEQVIAHVSVRLLRRHASLFLGVQEVQWIQEQLGIDYPGLLAEVQKVL
PPQRIADVLRRLLEEQIPIRNVRNIMESLIAWGPKEKDMLMLTEYVRGDLARFLAHRATQ
GAKVLPAVLLDGPVEQHIRQAIKQTPTGNYLALPPDEVTFLLDSIEAYAGTIARDDIALV
TSMDIRRYVRRMLEGKLDWLNVYSYQELGGLVELQPIGRVTA