Protein Info for H281DRAFT_05000 in Paraburkholderia bryophila 376MFSha3.1

Annotation: ATP synthase in type III secretion protein N

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 464 TIGR01026: ATPase, FliI/YscN family" amino acids 37 to 458 (422 residues), 543.6 bits, see alignment E=3.3e-167 TIGR02546: type III secretion apparatus H+-transporting two-sector ATPase" amino acids 42 to 459 (418 residues), 613.1 bits, see alignment E=2.2e-188 PF02874: ATP-synt_ab_N" amino acids 48 to 113 (66 residues), 27.8 bits, see alignment E=4.5e-10 PF00006: ATP-synt_ab" amino acids 170 to 379 (210 residues), 284.7 bits, see alignment E=6.9e-89 PF18269: T3SS_ATPase_C" amino acids 386 to 457 (72 residues), 69.4 bits, see alignment E=2.9e-23

Best Hits

Swiss-Prot: 70% identical to HRPB6_XANEU: Probable ATP synthase hrpB6 (hrpB6) from Xanthomonas euvesicatoria

KEGG orthology group: K03224, ATP synthase in type III secretion protein SctN [EC: 3.6.3.14] (inferred from 79% identity to bgf:BC1003_3632)

Predicted SEED Role

"Flagellum-specific ATP synthase FliI" in subsystem Flagellar motility or Flagellum

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.14

Use Curated BLAST to search for 3.6.3.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MDT9 at UniProt or InterPro

Protein Sequence (464 amino acids)

>H281DRAFT_05000 ATP synthase in type III secretion protein N (Paraburkholderia bryophila 376MFSha3.1)
MIELETPARDKAAATHDGLLGGAGLRQLSDAIEREILASVSIRQVGKVVEVIGTLIKVAG
VDLKLGELCELRAPGGQLMQHGEVIGFTRDYALVSPFSRLSDVSRSTQVVGLGRPLSIKV
GDKLLGRVIDALGEPIDGLGPIDIDRYRPIFADPPSPMNRRMIEASMATGVRVIDAMTTL
AEGQRMGIFAPAGVGKSTLLGMLARGAQCDINVIALIGERGREVREFVELILGPEGMARS
VVVCATSDRSSIERSKAAYVATAIAEHFRDEGKRVLLMMDSLTRFARAGREIGLAAGEPP
ARRGFPPSIFAELPRLLERAGMGETGSITALYTVLAEDDSGSDPIAEEVRGVLDGHLILS
REIAAQNRYPAIDVLGSLSRVMPQVVSREFMASSSRLRKLLAKHREVEMLLQIGEYQPGT
NALADEAIEKIDALKAFLSQATDSYADPAATEAALHELAQGQAV