Protein Info for H281DRAFT_04998 in Paraburkholderia bryophila 376MFSha3.1

Annotation: type III secretion protein T

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 283 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 41 to 62 (22 residues), see Phobius details amino acids 71 to 75 (5 residues), see Phobius details amino acids 79 to 99 (21 residues), see Phobius details amino acids 130 to 153 (24 residues), see Phobius details amino acids 163 to 177 (15 residues), see Phobius details amino acids 189 to 210 (22 residues), see Phobius details amino acids 226 to 246 (21 residues), see Phobius details TIGR01401: type III secretion apparatus protein SpaR/YscT/HrcT" amino acids 11 to 251 (241 residues), 199.7 bits, see alignment E=3e-63 PF01311: Bac_export_1" amino acids 17 to 250 (234 residues), 160.7 bits, see alignment E=2.3e-51

Best Hits

KEGG orthology group: K03228, type III secretion protein SctT (inferred from 61% identity to bug:BC1001_6044)

Predicted SEED Role

"Flagellar biosynthesis protein FliR" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MEE0 at UniProt or InterPro

Protein Sequence (283 amino acids)

>H281DRAFT_04998 type III secretion protein T (Paraburkholderia bryophila 376MFSha3.1)
MNAYLLEHGLQFSQYLAVWGVCSLRLFALMTLFPPTSDGVLQGVVRNGVALSFSMFVAAG
QPDSFGASLTGLTLLTIGLRETFIGIAMGFAASTVFWVAEGAGSYLDNLTGFNSAQLQNP
MLSQQSTPSATLLGQVATVAFWSLGGMQFLLEALYASYKWWPVSASIPASVNVLDAFVMH
QTDTLMQTVAKLAAPMLLVLLLIDMGVNLASKSAQELELSALSQPIKGAVAVLMMAVFAG
IFVTQVRDQLDLRLLKTSLEALARGETKASVDAPATVPSRPLR