Protein Info for H281DRAFT_04996 in Paraburkholderia bryophila 376MFSha3.1

Annotation: type III secretion protein C

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 594 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF03958: Secretin_N" amino acids 107 to 168 (62 residues), 33 bits, see alignment E=5.9e-12 amino acids 176 to 345 (170 residues), 47.5 bits, see alignment E=1.7e-16 TIGR02516: type III secretion outer membrane pore, YscC/HrcC family" amino acids 306 to 593 (288 residues), 322.2 bits, see alignment E=2.4e-100 PF00263: Secretin" amino acids 434 to 593 (160 residues), 125.4 bits, see alignment E=1.8e-40

Best Hits

KEGG orthology group: K03219, type III secretion protein SctC (inferred from 52% identity to brh:RBRH_03541)

Predicted SEED Role

"Type III secretion outermembrane pore forming protein (YscC,MxiD,HrcC, InvG)" in subsystem Type III secretion systems, extended

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MI13 at UniProt or InterPro

Protein Sequence (594 amino acids)

>H281DRAFT_04996 type III secretion protein C (Paraburkholderia bryophila 376MFSha3.1)
MKSKLGRCAIGAALLLCLTTAHAAPIKWRPGLVQISVESKDVKDVLSDFAASQGIIISIA
PNIQGTVSGRFNLPPRKFIDTMAATFGFVWFYDGSVLSISAANDVSTRVINLDFAGTENL
RQTLKQIGLETDRFPIVYDPVQGVALVTGPSRLLSLVSDVAARIDQNANRRTGSEVRVYP
LKNGWADDHKVVIDGKTVIVPGVASVLSSLYHPQNDSDKKGNSRGATPDVTPSVRPVDAM
ADVRGGTSGGSPYPDNAGVNPPLPGLFGAPLPSAAGPVGAPSQGAHNGNDASGRGAPSTA
ALPDGAGSLPVIIADPRTNSVLVRDLPQRVDQYKPLIDRLDVKRRMIEIEANIIQINDNA
LKQIGVDWRAHNSHVDFQTGNGVTSANSFNGQLNPTFTGTDANGNTIANVTPAGLSLTAV
VGDAGRYLLARVNALEQDDLARVDASPKVATLDNVEAVMDNKTRFFVKVAGFTSSDLFSV
SVGNTLRVLPMVTDDEGKTQIKLQVHVEDGQIVPGQTTDQIPQIATSEINTEAVVTEGQS
LLIAGYRIDNQTNGESGVPVLSKIPFLGGLFRYRQKQNSHMERLVLLSPRVIEF