Protein Info for H281DRAFT_04994 in Paraburkholderia bryophila 376MFSha3.1

Annotation: Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 160 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF01464: SLT" amino acids 27 to 131 (105 residues), 74.9 bits, see alignment E=2e-25

Best Hits

Swiss-Prot: 31% identical to PBL_ECO57: Peptidoglycan-binding-like protein (pbl) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 73% identity to bug:BC1001_3560)

Predicted SEED Role

"Putative IpgF protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (160 amino acids)

>H281DRAFT_04994 Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) (Paraburkholderia bryophila 376MFSha3.1)
MCLLKPRIAGAAVCSLVMFAAAPAYADCFDEAAAYQHVNPTILRAIAWQESHYRADAVHK
NANGSIDYGLMQINSIHLSALARYGIGQEALMTPCKNVYIAAWQLRRQVVKYGNTWAAVG
AYHSATPALRDDYARRIAAIVERWSMGSASVSAASGMPAP