Protein Info for H281DRAFT_04982 in Paraburkholderia bryophila 376MFSha3.1

Annotation: transcriptional regulator, MerR family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 PF13411: MerR_1" amino acids 1 to 68 (68 residues), 62.4 bits, see alignment E=5.4e-21 TIGR02044: Cu(I)-responsive transcriptional regulator" amino acids 1 to 126 (126 residues), 180.8 bits, see alignment E=5.4e-58 PF00376: MerR" amino acids 2 to 39 (38 residues), 51.9 bits, see alignment E=7.7e-18 PF09278: MerR-DNA-bind" amino acids 44 to 108 (65 residues), 78.6 bits, see alignment E=6.7e-26

Best Hits

Swiss-Prot: 64% identical to HMRR_SINMW: HTH-type transcriptional regulator HmrR (hmrR) from Sinorhizobium medicae (strain WSM419)

KEGG orthology group: None (inferred from 85% identity to bgf:BC1003_2279)

Predicted SEED Role

"Transcriptional regulator, MerR family" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (150 amino acids)

>H281DRAFT_04982 transcriptional regulator, MerR family (Paraburkholderia bryophila 376MFSha3.1)
MNIGEAARASGVTAKMIRYYESVGLLAAKSRTTAGYRVYGPQEVHSLRFIRRARRLGFLV
EDIRRLLALWHDRTRASAEVKAIALDHVAELDRRIAELTDMRDTLAHLANHCHGDDRPEC
PIIEGLADVGMVSAESGNGCKGLSKADVNA