Protein Info for H281DRAFT_04973 in Paraburkholderia bryophila 376MFSha3.1

Annotation: Excinuclease ABC subunit B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 697 TIGR00631: excinuclease ABC subunit B" amino acids 26 to 680 (655 residues), 1070.5 bits, see alignment E=0 PF04851: ResIII" amino acids 37 to 140 (104 residues), 38.4 bits, see alignment E=3.6e-13 PF17757: UvrB_inter" amino acids 180 to 270 (91 residues), 112.6 bits, see alignment E=2.4e-36 PF00271: Helicase_C" amino acids 458 to 565 (108 residues), 75.1 bits, see alignment E=1.5e-24 PF12344: UvrB" amino acids 572 to 614 (43 residues), 75.3 bits, see alignment 8e-25 PF02151: UVR" amino acids 649 to 682 (34 residues), 27 bits, see alignment (E = 8.9e-10)

Best Hits

Swiss-Prot: 91% identical to UVRB_BURPS: UvrABC system protein B (uvrB) from Burkholderia pseudomallei (strain K96243)

KEGG orthology group: K03702, excinuclease ABC subunit B (inferred from 99% identity to bug:BC1001_1138)

MetaCyc: 68% identical to UvrABC excision nuclease subunit B (Escherichia coli K-12 substr. MG1655)
3.1.25.-

Predicted SEED Role

"Excinuclease ABC subunit B" in subsystem DNA repair, UvrABC system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MBQ7 at UniProt or InterPro

Protein Sequence (697 amino acids)

>H281DRAFT_04973 Excinuclease ABC subunit B (Paraburkholderia bryophila 376MFSha3.1)
MSEQHLTEVDDALDESRFVRFEGSPFQLYQPYPPAGDQPTAIETLVEGVEDGLSFQTLLG
VTGSGKTFTMANTIARLGRPAIVFAPNKTLAAQLYSEFREFFPRNAVEYFVSYYDYYQPE
AYVPQRDLFIEKDSSINEHIEQMRLSATKSLMERRDVVIVATVSAIYGIGNPSEYHQMIL
TLRTGDKLGQRDIIARLIAMQYNRNEADFQRGSFRVRGDTIDIFPAEHAEMAVRVELFDD
EVETLQLFDPLTGRVRQKIPRFTVYPSSHYVTPRDTVVRAVETIKAELRERLEFFYSEGK
LVEAQRLEQRTRFDLEMLQELGFCKGIENYSRHFSGAAPGEPPPTLVDYLPSDAIMLLDE
SHVLIGQLNGMYNGDRARKENLVDYGFRLPSALDNRPLKFNEFERKMRQVVFVSATPADY
EKKTSGQVAEQLVRPTGLVDPEIEVRPARSQVDDVLAEINERVKAGDRVLVTVLTKRMAE
QLTEFLSDHGVKVRYLHSDIDTVERVEIIRDLRLGTFDVLVGINLLREGLDIPEVSLVAI
LDADKEGFLRAERSLIQTIGRAARNVNGKAILYADKVTDSMRRAIDETERRRAKQIAFNL
ERGITPRGVVKRIRDIIDGVYNVDDARAELKEQQTRAKFEDMSEKQLAKELKRLEKQMME
HAKNLEFEKAAQTRDQLALLRQRVFGANVGDHVSGVD