Protein Info for H281DRAFT_04972 in Paraburkholderia bryophila 376MFSha3.1
Annotation: hypothetical protein
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 70% identical to Y840_BRUA2: UPF0423 protein BAB2_0840 (BAB2_0840) from Brucella abortus (strain 2308)
KEGG orthology group: K07230, (no description) (inferred from 96% identity to bxe:Bxe_A3152)MetaCyc: 70% identical to ferrous iron uptake system, iron-binding protein FtrA (Brucella abortus 2308)
Predicted SEED Role
"Periplasmic protein p19 involved in high-affinity Fe2+ transport" in subsystem Campylobacter Iron Metabolism or Transport of Iron
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A2Z5MD95 at UniProt or InterPro
Protein Sequence (182 amino acids)
>H281DRAFT_04972 hypothetical protein (Paraburkholderia bryophila 376MFSha3.1) MRISSFVRGGIATAAAMAALSATAAEYPIGKQQIQGGMEIGAVYLQPITMEPEGMMRKAS DSDIHLEADIHAVKNNPTGFAEGDWMPYLQVRYELTKAGSKETQKGDMMAMVANDGPHYG DNVKLQGPGKYHLKMIVEAPMQTGHMAFGRHVDKETGVGPWFKPITLEYDFTFAGIGKKG GY