Protein Info for H281DRAFT_04970 in Paraburkholderia bryophila 376MFSha3.1
Annotation: high-affinity iron transporter
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
KEGG orthology group: K07243, high-affinity iron transporter (inferred from 96% identity to bug:BC1001_1141)MetaCyc: 50% identical to ferrous iron uptake system, inner membrane protein FtrC (Brucella abortus 2308)
Predicted SEED Role
"High-affinity iron permease"
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A2Z5MCA2 at UniProt or InterPro
Protein Sequence (281 amino acids)
>H281DRAFT_04970 high-affinity iron transporter (Paraburkholderia bryophila 376MFSha3.1) MGQILFIVWRESVEALLVVGILYAWLKNGDDDARRGLPYLWGGVVVGLIAAVALGAALVG FTEVLSGDAQDYFQTAMVLVACVLIVQMVLWMKQHGRSLKRDMERSLQQSQRDSNWWGVA LLVALAIAREGSETVIFLYGLGFGQSGHVDTNQMLAVVIGLGLALLTFYVLQLGGKFFSW RLFFRVTEIMLLFLGAGLFQTGVDKLIDKEFLPTIVDQMWNTSAVLDDSSTFGSLVATLT GYRAHPALMNLIAYAVYWAVVYLLLRRANRKPAQQAAGRAA