Protein Info for H281DRAFT_04958 in Paraburkholderia bryophila 376MFSha3.1

Annotation: glutamate racemase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 58% identical to MURI_RALSO: Glutamate racemase (murI) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K01776, glutamate racemase [EC: 5.1.1.3] (inferred from 89% identity to bug:BC1001_1153)

Predicted SEED Role

"Glutamate racemase (EC 5.1.1.3)" in subsystem Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis or Peptidoglycan Biosynthesis (EC 5.1.1.3)

MetaCyc Pathways

peptidoglycan biosynthesis I (meso-diaminopimelate containing) (12/12 steps found)
UDP-N-acetylmuramoyl-pentapeptide biosynthesis I (meso-diaminopimelate containing) (8/8 steps found)
UDP-N-acetylmuramoyl-pentapeptide biosynthesis II (lysine-containing) (7/8 steps found)
peptidoglycan biosynthesis III (mycobacteria) (11/15 steps found)
peptidoglycan biosynthesis II (staphylococci) (12/17 steps found)
peptidoglycan biosynthesis IV (Enterococcus faecium) (12/17 steps found)
peptidoglycan biosynthesis V (β-lactam resistance) (11/17 steps found)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.1.1.3

Use Curated BLAST to search for 5.1.1.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (294 amino acids)

>H281DRAFT_04958 glutamate racemase (Paraburkholderia bryophila 376MFSha3.1)
MPEQSSSLNASIGSLSADSRAPVGIFDSGLGGLSVLRAVRAQLPDEALLYVADSLYAPYG
ERDDDFIADRTLAIGEWLVKQGAKALVVACNTATAQSIALVREKLSIPLVGVEPGIKPAA
LQSKTRVAGVLATQVTLRSARFQALLERYAADCRFLCQPGHGLVQAVERCDVGSAELRAL
LRGYLQPMLDAGADTLVLGCTHYPFFDAAIRDIVGDRLALIDTSVAIARQLERVLEQHGV
RAAPHTADAALPRFYSTGDGTHLRQLVATLLEIDAQVERVLIPSRRTAPSSQPA