Protein Info for H281DRAFT_04938 in Paraburkholderia bryophila 376MFSha3.1

Annotation: membrane fusion protein, multidrug efflux system

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 380 transmembrane" amino acids 30 to 50 (21 residues), see Phobius details PF13533: Biotin_lipoyl_2" amino acids 68 to 115 (48 residues), 55.9 bits, see alignment 5.8e-19 PF00529: CusB_dom_1" amino acids 120 to 361 (242 residues), 28.3 bits, see alignment E=2.8e-10 PF16576: HlyD_D23" amino acids 128 to 310 (183 residues), 59.2 bits, see alignment E=7.2e-20 PF13437: HlyD_3" amino acids 235 to 354 (120 residues), 42.4 bits, see alignment E=2.1e-14

Best Hits

Swiss-Prot: 39% identical to EMRA_ACIBT: Colistin resistance protein EmrA (emrA) from Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)

KEGG orthology group: K03543, multidrug resistance protein A (inferred from 71% identity to bgl:bglu_1g30250)

Predicted SEED Role

"Membrane fusion component of tripartite multidrug resistance system" in subsystem Multidrug Resistance, Tripartite Systems Found in Gram Negative Bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MBN0 at UniProt or InterPro

Protein Sequence (380 amino acids)

>H281DRAFT_04938 membrane fusion protein, multidrug efflux system (Paraburkholderia bryophila 376MFSha3.1)
MSTTADSPSRPRPAEESPSSGVRRPSRRTVLIALGVVALIAGGIWLARWWTVGRFIESTD
DAYLQADSVTVAPKVSGYVTEVYVADNQMVKPGDPLVHLDARQYQVALDQALATIDARKA
DIERAQADIKQQQSNIAQAQAQERVARVSAQHASDEVRRYAPLIATGAESSERMAELTST
RDQANATLAANAAAVDAARSQIGSATAQLAQARAQLEAAEASAQQSRLDLENTMVRSALG
GKVGDRTVRVGQYVQPGTRMLTVVPVRSTYLLANFKETQVGRMRVGQPVEMHVDALPGHT
LHGVIDSFSPGTGSQFALLPPENATGNFTKIVQRVPVRIRIDTGAETRSVLLPGLSVTVD
VDTRSARERDARIDAENRRG