Protein Info for H281DRAFT_04900 in Paraburkholderia bryophila 376MFSha3.1

Annotation: microcin C transport system permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 371 transmembrane" amino acids 41 to 62 (22 residues), see Phobius details amino acids 165 to 190 (26 residues), see Phobius details amino acids 202 to 221 (20 residues), see Phobius details amino acids 225 to 244 (20 residues), see Phobius details amino acids 286 to 308 (23 residues), see Phobius details amino acids 328 to 352 (25 residues), see Phobius details PF12911: OppC_N" amino acids 27 to 64 (38 residues), 32.7 bits, see alignment 5.4e-12 PF00528: BPD_transp_1" amino acids 177 to 362 (186 residues), 110.6 bits, see alignment E=7.9e-36

Best Hits

Swiss-Prot: 51% identical to YEJE_ECOLI: Inner membrane ABC transporter permease protein YejE (yejE) from Escherichia coli (strain K12)

KEGG orthology group: K13895, microcin C transport system permease protein (inferred from 90% identity to bxe:Bxe_A2991)

MetaCyc: 51% identical to putative oligopeptide ABC transporter membrane subunit YejE (Escherichia coli K-12 substr. MG1655)
3.6.3.23-RXN [EC: 7.4.2.6]

Predicted SEED Role

"Oligopeptide transport system permease protein OppC (TC 3.A.1.5.1)" in subsystem ABC transporter oligopeptide (TC 3.A.1.5.1) (TC 3.A.1.5.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MBJ9 at UniProt or InterPro

Protein Sequence (371 amino acids)

>H281DRAFT_04900 microcin C transport system permease protein (Paraburkholderia bryophila 376MFSha3.1)
MSSSTRVSSSTGLTDDASAAPRGLVPSPWRRTWLRFRRQRLGYWSLMILASLFVLSLLGE
VLSNDRPLVVRYDGHYYFPIVKDYPETLFGGDFPARANYLDPYIRSRLEANGNFAVYPPN
HFHYDTIDYFAAHPYPAPPTSSNWLGTDQYGRDVLARLLYGFRLSVSMALALTVSGVLIG
VAAGAVQGFYGGRTDLIGQRLIEIWSSMPDLYLLIIFASIFEPTLWLLFILLSMFGWLVL
SDYVRAEFLRNRSLDYVKAARTMGLSNGQIIWRHVLPNSLTPVITFLPFRMSAAILSLTS
LDFLGLGVPPPTPSLGELLQEGKNNLDAWWISVSAFAALVVTLLLLTFIGDALRNALDTR
SRGSAFGGAPR