Protein Info for H281DRAFT_04888 in Paraburkholderia bryophila 376MFSha3.1

Annotation: protein of unknown function (DUF4118)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 467 transmembrane" amino acids 36 to 58 (23 residues), see Phobius details amino acids 64 to 104 (41 residues), see Phobius details amino acids 110 to 129 (20 residues), see Phobius details amino acids 304 to 323 (20 residues), see Phobius details PF13492: GAF_3" amino acids 211 to 316 (106 residues), 28.5 bits, see alignment E=1.8e-10 PF16963: PelD_GGDEF" amino acids 340 to 462 (123 residues), 157.2 bits, see alignment E=1.8e-50

Best Hits

KEGG orthology group: None (inferred from 82% identity to bph:Bphy_1835)

Predicted SEED Role

"Extracellular Matrix protein PelD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MBI6 at UniProt or InterPro

Protein Sequence (467 amino acids)

>H281DRAFT_04888 protein of unknown function (DUF4118) (Paraburkholderia bryophila 376MFSha3.1)
VNTVTAQSAASAAKPRHSNPLGNLSALRRIVAPAVARPFSIVETIVFVAAAGALSWALDR
NDPFLLHTGFPWLWFAPLIVALRYGTLLGLLACAMLIGAWQVLMHGSPDAWPTLFFTGGL
LQTIVAGHFGDTWGNRAQRANALNDYLNDRLVAITNSHYLMRLSHERLEKDLLSKPTTLR
DSITELRRLSVAHGLDSAKDVPSHDLPGAHALLEFVAQACQIEVAALYPVHGGKLGRETL
ARIGDAFELDPRDELVARALETQAVAHLKSGEHPVTNTGLLVCAPMISADGRLIAVLAIK
RMPFLSLNFDNLQLLLVLLGYYADGVEHSQQVRTILDALPDCPYEFALDVSRLTRLEHAA
GITSSLVALVFPHDDEGDSFFEHVMRRRRALDLMWPVKAAGQSVLINLMPATDATGVDGY
LARIEASLRAQFNLDLEGARIGVHTLHLGGEPAPALKRLLVRSGVDV