Protein Info for H281DRAFT_04884 in Paraburkholderia bryophila 376MFSha3.1

Annotation: extracellular protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 signal peptide" amino acids 1 to 41 (41 residues), see Phobius details PF03537: Glyco_hydro_114" amino acids 55 to 287 (233 residues), 85.7 bits, see alignment E=1.5e-28

Best Hits

KEGG orthology group: None (inferred from 65% identity to bpy:Bphyt_1499)

Predicted SEED Role

"Extracellular Matrix protein PelA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MDX4 at UniProt or InterPro

Protein Sequence (300 amino acids)

>H281DRAFT_04884 extracellular protein (Paraburkholderia bryophila 376MFSha3.1)
MSIEKRQRRDMCAFYRRVVCAARLVLVGLLSSIAHERAWADAGAGPSIALFYGTQPPVSQ
LRNFDVAVVEPDSGFEPLKHKNPDTAWFAYVSVGEVEPQRPYYAAIPKAWQLGDNTVWGA
KVIDQDAADWPAFYVEHVIAPLWKKGYRGFFLDTLDSYQIVAKTDAARARQERGLVAVVR
AIKARYPRARLIFNRGFEILPQVHSLVYAVAFESLYRGWDQAGKRYTEITQADRDWLLAQ
AKTIREQYRLPVLAIDYCASADSVCAADTVNRISAAGLVPYVTDGGLQTVGVGPARAMRQ