Protein Info for H281DRAFT_04869 in Paraburkholderia bryophila 376MFSha3.1

Annotation: imidazolonepropionase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 409 TIGR01224: imidazolonepropionase" amino acids 23 to 398 (376 residues), 472.4 bits, see alignment E=4.7e-146 PF01979: Amidohydro_1" amino acids 58 to 399 (342 residues), 66.1 bits, see alignment E=3.4e-22 PF07969: Amidohydro_3" amino acids 109 to 401 (293 residues), 49.5 bits, see alignment E=4.9e-17

Best Hits

Swiss-Prot: 94% identical to HUTI_PARPJ: Imidazolonepropionase (hutI) from Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)

KEGG orthology group: K01468, imidazolonepropionase [EC: 3.5.2.7] (inferred from 94% identity to bpy:Bphyt_1534)

MetaCyc: 64% identical to imidazolonepropionase (Pseudomonas fluorescens)
Imidazolonepropionase. [EC: 3.5.2.7]

Predicted SEED Role

"Imidazolonepropionase (EC 3.5.2.7)" in subsystem Histidine Degradation (EC 3.5.2.7)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.2.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (409 amino acids)

>H281DRAFT_04869 imidazolonepropionase (Paraburkholderia bryophila 376MFSha3.1)
MKQTVWHQLNLCPQGDPEHTLRDAAIAVENGNIVWLGAAAGLPAEYADWPRENLHGAWVT
PGLVDCHTHLVYGGQRADEFAQRLAGVSYEEIARQGGGIVSTVRATRAATEDELFRQSAA
RLEPLLAEGVTAVEIKSGYGLDLDSERKMLRVARQLGERYPVTVYTTFLGAHALPPEFAG
RADAYIDEVCNTMLPALADEGLVDAVDVFCERIGFSLEQSERVFNAAARYKLPVKMHAEQ
LSNGGGTALAARHRALSADHLEFLDEAGVAAMNEAGTVAVLLPGAYYFIRETQLPPLDLL
RRYEVPIAISTDSNPGTSPTTSLLLMMNMASTLFRMTVPEVLKGVTSHAARALGKADRHG
SLEVGRAADFAVWAVDSLAELAYWIGRPLCARVVRAGETVYRPSTRDAN