Protein Info for H281DRAFT_04860 in Paraburkholderia bryophila 376MFSha3.1

Annotation: glucose-1-phosphate adenylyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 421 TIGR02091: glucose-1-phosphate adenylyltransferase" amino acids 14 to 391 (378 residues), 499.8 bits, see alignment E=2.3e-154 PF12804: NTP_transf_3" amino acids 16 to 172 (157 residues), 34.2 bits, see alignment E=2.8e-12 PF00483: NTP_transferase" amino acids 16 to 285 (270 residues), 221.6 bits, see alignment E=1.3e-69

Best Hits

Swiss-Prot: 97% identical to GLGC_PARXL: Glucose-1-phosphate adenylyltransferase (glgC) from Paraburkholderia xenovorans (strain LB400)

KEGG orthology group: K00975, glucose-1-phosphate adenylyltransferase [EC: 2.7.7.27] (inferred from 97% identity to bug:BC1001_1270)

MetaCyc: 65% identical to glucose-1-phosphate adenylyltransferase (Escherichia coli K-12 substr. MG1655)
Glucose-1-phosphate adenylyltransferase. [EC: 2.7.7.27]

Predicted SEED Role

"Glucose-1-phosphate adenylyltransferase (EC 2.7.7.27)" in subsystem Glycogen metabolism (EC 2.7.7.27)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.27

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MBF5 at UniProt or InterPro

Protein Sequence (421 amino acids)

>H281DRAFT_04860 glucose-1-phosphate adenylyltransferase (Paraburkholderia bryophila 376MFSha3.1)
MDTPARLNDLQRTTLAIVLAGGRGTRLGPLTNKRVKPAVHFGGKYRIIDFALSNCLNSGI
RRIAVVTQYKAHSLLRHLQRGWSFLRGEFGEFIDLWPAQQRVEGAHWYRGTADAVFQNLD
IIRSIRPKYVVVLAGDHIYKMDYTRMIADHADSGADCTVGCIEVPRMDAVAFGVMAVDEN
RRVVGFVEKPADPPAIPGRPDTALASMGIYVFNADYLYSLLEENISTVDTDHDFGKDILP
RVVTQGTAIAHPFGMSCVSSDPNVEPYWRDVGTIDAYWAANLDLASTIPTLDLYDRSWPI
WTYQEQLPPAKFVRDLKGLQGSGNNLLACGGCVISGSQISRSVLSSNVKVSSFCNINEAV
LLPQVTVGASCRLQKVVVDRGCAIPDGTVIGEDPVADAERFYRTDDGVVLVTPESLRQEA
T