Protein Info for H281DRAFT_04853 in Paraburkholderia bryophila 376MFSha3.1

Annotation: UDP-N-acetylmuramyl pentapeptide phosphotransferase/UDP-N-acetylglucosamine-1-phosphate transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 365 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 45 to 64 (20 residues), see Phobius details amino acids 70 to 91 (22 residues), see Phobius details amino acids 101 to 122 (22 residues), see Phobius details amino acids 133 to 154 (22 residues), see Phobius details amino acids 162 to 181 (20 residues), see Phobius details amino acids 187 to 206 (20 residues), see Phobius details amino acids 217 to 236 (20 residues), see Phobius details amino acids 242 to 261 (20 residues), see Phobius details amino acids 307 to 325 (19 residues), see Phobius details amino acids 330 to 353 (24 residues), see Phobius details PF00953: Glycos_transf_4" amino acids 76 to 233 (158 residues), 114 bits, see alignment E=3.4e-37

Best Hits

KEGG orthology group: None (inferred from 98% identity to bug:BC1001_0686)

Predicted SEED Role

"Undecaprenyl-phosphate N-acetylglucosaminyl 1-phosphate transferase (EC 2.7.8.-)" in subsystem Methicillin resistance in Staphylococci or Teichoic and lipoteichoic acids biosynthesis (EC 2.7.8.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.8.-

Use Curated BLAST to search for 2.7.8.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MAN6 at UniProt or InterPro

Protein Sequence (365 amino acids)

>H281DRAFT_04853 UDP-N-acetylmuramyl pentapeptide phosphotransferase/UDP-N-acetylglucosamine-1-phosphate transferase (Paraburkholderia bryophila 376MFSha3.1)
MLSFALGFIVSLLITLLIVRYAHLHEKFSTDTDLAGVQKFHVRPVPRIGGTGILVGLIVS
AVQLRYAYPAVSGGILGLIACGMPAFGSGLVEDLTKRVSPLARLVCTMAAAALAYFLLDI
AVTRISVPPLDFLLSYAVISCAVTVLAVAALANAINIIDGFNGLASMVAFMMFASLAYVA
FQVHDPIVLSASFMMMGAVLGFFIWNFPAGLIFLGDGGAYFIGFMLAELSIMLVMRNRDV
SAWYPVLLFMYPIFETCFSIYRKKFIRGMSPGIPDGVHLHMLVYKRLMRWAVGARTAREL
TRRNSLTSPYLWLLCLIAVVPATLFWRHTLHLFCFVVVFAATYVWLYVSIVRFKSPRWMV
VRKGK