Protein Info for H281DRAFT_04842 in Paraburkholderia bryophila 376MFSha3.1

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 874 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 101 to 123 (23 residues), see Phobius details amino acids 131 to 150 (20 residues), see Phobius details amino acids 187 to 215 (29 residues), see Phobius details amino acids 227 to 250 (24 residues), see Phobius details amino acids 300 to 321 (22 residues), see Phobius details amino acids 328 to 348 (21 residues), see Phobius details amino acids 364 to 384 (21 residues), see Phobius details amino acids 397 to 420 (24 residues), see Phobius details amino acids 432 to 452 (21 residues), see Phobius details amino acids 459 to 480 (22 residues), see Phobius details amino acids 845 to 864 (20 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 81% identity to bgf:BC1003_0768)

Predicted SEED Role

"FIG00464800: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (874 amino acids)

>H281DRAFT_04842 hypothetical protein (Paraburkholderia bryophila 376MFSha3.1)
LLLLIALPIVAALPGLIGLYHANPMLYLGAVARNYRPGLTPGFPYLDPNNAFTAQALGYR
AALDWIGGIVPWWNYFSGVGLPLAAEYQPAVFFPPTLMLLLPNGMLLQHILLQIIAGWGA
YGLLRQLALGRLAAATGGMLFAFNGALAWFDHAPALPVPFLPWILWGVDRVFAKAALGMP
RGWRLFAVALWMNLVAGFPETAYLNGLLALVWALLRFRQAPGFRLAFIVRLAIGGVVGLA
LGAPQVLAFFEFLPHAWLGGHDGGFAHSALDPAGVLPSLLFPYVYGSIASGAAAWDRLGA
IWGGIGGYVSIAVVVVGLYGVMLRRTAITWLLLCWLLMALGKSFNVPVVSASWNMIPGVA
QAAFYRYAVPTWELSFIILAAQALDDLRGQQHERAAYLCRITVLAALLLLAGVIYTGLLW
HHLRDSVAVRNAALASVAWGVISVGAFATIMLHCRPARAATAIAVFLVVDSVLMFTVPTL
SNPRSGEVDMDAIGFLQKNVGLQRVYSLGPIQANYGAYFGIAAINHNYLPINRRWVDWIR
ANLDAYADPIAFIGNYRTAGSTVPTSSQELVRHLENYEWIGVKYVIARGGDNPFVSTLSS
KTDVATQSALPVMPGEVVSGTLPPGLTDKTVTIDHIGMLIGNYGNTSEGIITAEVCVDSV
CASGQRDLNGSSDNSMFYIPLARPLPVEARSVVNYRFTRSGGSKPLALWMTTVHEPADDQ
QLKRLDGLLTGHGLQIKLVIRDDKPSLGKQVFADQVMNIYELGQPKPYFEELGQACQITS
HDRERVTAYCSAPSTLLRRELFFPGWSAKVNGSLAQISEHKDLFQTITLPAGESSVVFSY
EPPHMIWAWTAMLVACSMLFMPVIKTKSQQRKRQ