Protein Info for H281DRAFT_04838 in Paraburkholderia bryophila 376MFSha3.1

Annotation: 4-amino-4-deoxy-L-arabinose transferase and related glycosyltransferases of PMT family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 575 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 70 to 94 (25 residues), see Phobius details amino acids 101 to 121 (21 residues), see Phobius details amino acids 127 to 144 (18 residues), see Phobius details amino acids 151 to 169 (19 residues), see Phobius details amino acids 188 to 211 (24 residues), see Phobius details amino acids 223 to 240 (18 residues), see Phobius details amino acids 285 to 305 (21 residues), see Phobius details amino acids 312 to 330 (19 residues), see Phobius details amino acids 341 to 358 (18 residues), see Phobius details amino acids 365 to 382 (18 residues), see Phobius details PF13231: PMT_2" amino acids 81 to 238 (158 residues), 33.5 bits, see alignment E=2.5e-12

Best Hits

KEGG orthology group: None (inferred from 59% identity to bgf:BC1003_0766)

Predicted SEED Role

"FIG00464553: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (575 amino acids)

>H281DRAFT_04838 4-amino-4-deoxy-L-arabinose transferase and related glycosyltransferases of PMT family (Paraburkholderia bryophila 376MFSha3.1)
MKKNNFTNLKHSNLIVHLLFIFLLGFFVYQNVEWVIKYRFDQSLDIDESGYLAVAVAFAK
AKMNGGWTGWWHAISAPLGFAPLVPLIASLVFIAFGINENLGFVCNIAFAVGTLVLMFVA
AHRVSSLFGLVASILLASLPNFVMFSRSFQFVSATTFFFFAAYVFFVFSEGFSRRRYAML
SGMALGAMILSRTMALAFLPAFAFSFLVYFYRVRGFSREICKNIVASILACLLVAMPWYL
ENFRSVFGYLFSFGYGSHAAEYGHSQGIFTLANWKARLDVIISQIHPAHFIMIVPAFIAA
FLVCLRKKNAIDSLILSGALLCLSSLFILSTSQNMGTGFDAPIYPVMILCAIMWIATSGI
KWLRIAYIALSLTFLSVASYAHEDLHRCLKMPKEFVEGIWGYGPLVNCVASIHGYLRTNE
FPPDNQPNFIQERDEAVAWRQLNRLVSSYLLEEDGSRSVVLLLSRHMILNANSIGLEMIK
GAGTILPMVQIDPAALEPTAASYSSWLAQAPHDSACFALMLDDQHGEFFPRADVSVMTQV
LSESEYERVTSFATPRSGQRLWVWQKKVPACRGLA