Protein Info for H281DRAFT_04833 in Paraburkholderia bryophila 376MFSha3.1

Annotation: WxcM-like, C-terminal

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF05523: FdtA
  • amino acids 5 to 132 (128 residues), 194.8 bits, E=2.3e-62

Best Hits

Swiss-Prot: 46% identical to FDTA_ANETH: TDP-4-oxo-6-deoxy-alpha-D-glucose-3,4-oxoisomerase (fdtA) from Aneurinibacillus thermoaerophilus

KEGG orthology group: None (inferred from 83% identity to bgf:BC1003_0757)

MetaCyc: 51% identical to dTDP-6-deoxy-3,4-keto-hexulose isomerase monomer (Streptomyces ravidus)
RXN-12839 [EC: 5.3.2.3]

Predicted SEED Role

"FIG01210424: hypothetical protein"

MetaCyc Pathways

• dTDP-3-acetamido-α-D-fucose biosynthesis (3/5 steps found)
• dTDP-α-D-ravidosamine and dTDP-4-acetyl-α-D-ravidosamine biosynthesis (3/6 steps found)
• superpathway of dTDP-glucose-derived O-antigen building blocks biosynthesis (6/19 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.2.3

Protein Sequence (136 amino acids)

>H281DRAFT_04833 WxcM-like, C-terminal (Paraburkholderia bryophila 376MFSha3.1)
MPLFDCKIIDLPKIADPRGNLTFMEGRRHIPFDIKRVFYIYDIPTGGSRGAHAHKELHQF
LICLSGSFDVALDDGTDKKTIRLNRPWQGLHIPPMIWAAELNFDPGSVCLVLASMAFNES
DYYRDYDQFLAALKSR