Protein Info for H281DRAFT_04809 in Paraburkholderia bryophila 376MFSha3.1

Annotation: adenylylsulfate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00455: adenylyl-sulfate kinase
  • amino acids 12 to 194 (183 residues), 222.5 bits, E=1.7e-70
• PF01583: APS_kinase
  • amino acids 28 to 181 (154 residues), 225 bits, E=4.8e-71
• PF13238: AAA_18
  • amino acids 32 to 143 (112 residues), 30.2 bits, E=6.3e-11

Best Hits

Swiss-Prot: 55% identical to CYSC_PSEE4: Adenylyl-sulfate kinase (cysC) from Pseudomonas entomophila (strain L48)

KEGG orthology group: K00860, adenylylsulfate kinase [EC: 2.7.1.25] (inferred from 82% identity to bug:BC1001_0640)

MetaCyc: 47% identical to Met14 (Saccharomyces cerevisiae)
Adenylyl-sulfate kinase. [EC: 2.7.1.25]

Predicted SEED Role

"Adenylylsulfate kinase (EC 2.7.1.25)" in subsystem Cysteine Biosynthesis or O-Methyl Phosphoramidate Capsule Modification in Campylobacter (EC 2.7.1.25)

MetaCyc Pathways

• superpathway of sulfate assimilation and cysteine biosynthesis (9/9 steps found)
• superpathway of L-methionine biosynthesis (by sulfhydrylation) (11/12 steps found)
• assimilatory sulfate reduction I (4/4 steps found)
• sulfate activation for sulfonation (2/2 steps found)
• assimilatory sulfate reduction IV (3/4 steps found)
• superpathway of sulfur amino acid biosynthesis (Saccharomyces cerevisiae) (7/10 steps found)

KEGG Metabolic Maps

• Purine metabolism
• Selenoamino acid metabolism
• Sulfur metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.25

Use Curated BLAST to search for 2.7.1.25

Protein Sequence (204 amino acids)

>H281DRAFT_04809 adenylylsulfate kinase (Paraburkholderia bryophila 376MFSha3.1)
MKQQLGGPVQRFHGAITLADRMRLLHQKPVTIWLTGLSGAGKSTIAFELERQLVCQGRAC
YVLDGDNVRHGLGSDLDFDQHDRHENIRRVAHVAQLMNDAGLIVITALISPTQADRTMAR
DIVGADKFVEIYLSAPFAVCARRDPKGLYAKALAGEIASFTGVSAPYESPVDPDITIDTA
TLTPAESVAGIFRYLHEHCLAQPA