Protein Info for H281DRAFT_04793 in Paraburkholderia bryophila 376MFSha3.1

Annotation: Glycosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 313 PF13692: Glyco_trans_1_4" amino acids 142 to 247 (106 residues), 29.2 bits, see alignment E=5.4e-11

Best Hits

KEGG orthology group: None (inferred from 62% identity to bge:BC1002_6594)

Predicted SEED Role

"Glycosyltransferase (EC 2.4.1.-)" (EC 2.4.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.-

Use Curated BLAST to search for 2.4.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5M8H3 at UniProt or InterPro

Protein Sequence (313 amino acids)

>H281DRAFT_04793 Glycosyltransferase (Paraburkholderia bryophila 376MFSha3.1)
VYKIFLLHPGRANYPELVAYQDYYAARGVDVVAGTLSDYKALADKADFLVWAIMGFYPKQ
LASDFVIHDYRSLSVGGSAGLKDIAKRYLNARPNLRIFQNTRQQNIMKFNDDVPSVILPM
GVPKWIFEVPQQPPDAEDIADFCYIGDMSFERGFHLVIEAFLENFREVDASLLLVGKPEP
RLYERYAGKRGLVFAGALPQREALGLVARSSIAVSYFPYHRPHCYQTPTKLLEYAALGKK
ILCNDSPSNVACCEDLHINSIITSSSIFTGMTAATIETAKPNQRANFTQLAWDNVIEKSN
INSYISLKINFSQ