Protein Info for H281DRAFT_04784 in Paraburkholderia bryophila 376MFSha3.1

Annotation: O-antigen ligase like membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 480 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 30 to 51 (22 residues), see Phobius details amino acids 63 to 82 (20 residues), see Phobius details amino acids 88 to 109 (22 residues), see Phobius details amino acids 121 to 140 (20 residues), see Phobius details amino acids 149 to 168 (20 residues), see Phobius details amino acids 173 to 190 (18 residues), see Phobius details amino acids 196 to 214 (19 residues), see Phobius details amino acids 225 to 244 (20 residues), see Phobius details amino acids 335 to 361 (27 residues), see Phobius details amino acids 373 to 394 (22 residues), see Phobius details amino acids 401 to 420 (20 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 89% identity to bug:BC1001_0531)

Predicted SEED Role

"FIG00456118: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5M9C1 at UniProt or InterPro

Protein Sequence (480 amino acids)

>H281DRAFT_04784 O-antigen ligase like membrane protein (Paraburkholderia bryophila 376MFSha3.1)
MRHQYAAPWIWIFLLPLALDYKATNATTGHFAQFIFVAPAVAAGLALLLIAPRFHERSRL
RTIVTTSLLLCVFGSVVAQLIQDNDGGNYLRVLLPFMLFLLGYLVACRPWSEQRIAQFEK
ALFAANVVSLVFTFVYGLATSGGLDDARFRIISVTLLGLQGVLLHEFVVAKRYSPFTIAV
FAGTVIVELLSVTRSLLVGTVLLFVIAMALSAPSMRQIWRAVARGLMVVVVLAGVAGIAV
LAVPNVAEHWTQRIFVAEATISGKDPTTITRLAEMRDQYDQVTASPETLLFGAGYGHYYR
YSPDYLPDLAGQFSKQDFYAINEWAAGHNFWVYQLFAGGLVFGIAMPLATLGALALCFFA
YRYWRSVVPDAPMLPILGRAIMLFAALPATSIGGNPLGPRFSGLVFGIGLGLMIATYTRL
QRALPARANRMSAARRMRAAASPDLPRRMQPGMGRTDVASTLGMSQTARLPGSNRPDIAR