Protein Info for H281DRAFT_04760 in Paraburkholderia bryophila 376MFSha3.1

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 262 transmembrane" amino acids 9 to 42 (34 residues), see Phobius details amino acids 52 to 56 (5 residues), see Phobius details amino acids 76 to 96 (21 residues), see Phobius details amino acids 107 to 127 (21 residues), see Phobius details amino acids 148 to 180 (33 residues), see Phobius details amino acids 192 to 210 (19 residues), see Phobius details amino acids 216 to 236 (21 residues), see Phobius details amino acids 242 to 261 (20 residues), see Phobius details PF01925: TauE" amino acids 12 to 259 (248 residues), 156.2 bits, see alignment E=5.9e-50

Best Hits

KEGG orthology group: K07090, (no description) (inferred from 94% identity to bpy:Bphyt_0802)

Predicted SEED Role

"Putative sulfate permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5M9A1 at UniProt or InterPro

Protein Sequence (262 amino acids)

>H281DRAFT_04760 hypothetical protein (Paraburkholderia bryophila 376MFSha3.1)
MALPHIDLLYSASGLFVGFLVGLTGVGGGSLMTPILVLLFNVHPATAVGTDLLYAAATKA
TGTLVHGLKGSVDWQVTLRLAAGSVPAATVTLVLLHRYGMDTPGASRLIQIVLGVALLVT
AVALVFRPQLAALGAHRQRTPSQGRTLGLTMLTGAVLGVLVSLTSVGAGAIGVTVLLLLY
PMLPTTRIVGSDIAHAVPLTLLAGAGHWLLGSVDWSMLLSLLVGSLPGIAVGSMLSARAP
DALLRNLLAATLTLVGVRLVLA