Protein Info for H281DRAFT_04751 in Paraburkholderia bryophila 376MFSha3.1

Annotation: Predicted arabinose efflux permease, MFS family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 403 transmembrane" amino acids 19 to 41 (23 residues), see Phobius details amino acids 48 to 67 (20 residues), see Phobius details amino acids 86 to 109 (24 residues), see Phobius details amino acids 120 to 139 (20 residues), see Phobius details amino acids 151 to 171 (21 residues), see Phobius details amino acids 177 to 196 (20 residues), see Phobius details amino acids 219 to 246 (28 residues), see Phobius details amino acids 252 to 270 (19 residues), see Phobius details amino acids 282 to 299 (18 residues), see Phobius details amino acids 305 to 329 (25 residues), see Phobius details amino acids 341 to 362 (22 residues), see Phobius details amino acids 369 to 391 (23 residues), see Phobius details PF07690: MFS_1" amino acids 22 to 287 (266 residues), 54.8 bits, see alignment E=3.8e-19 amino acids 225 to 395 (171 residues), 39.1 bits, see alignment E=2.3e-14

Best Hits

Swiss-Prot: 78% identical to Y2043_BURMA: Uncharacterized MFS-type transporter BMA2043 (BMA2043) from Burkholderia mallei (strain ATCC 23344)

KEGG orthology group: None (inferred from 96% identity to bgf:BC1003_0521)

Predicted SEED Role

"Xanthine transporter,putative" in subsystem Purine Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5M7X9 at UniProt or InterPro

Protein Sequence (403 amino acids)

>H281DRAFT_04751 Predicted arabinose efflux permease, MFS family (Paraburkholderia bryophila 376MFSha3.1)
MSTDTATPRSEFATTMQIIPVVFFTFLCYLTIGIPLAVLPGYVHDDLGYSAVLAGAAISV
QYLATLASRPLAGRSADTLGPKRTVTIGLLGCGASGVLLLLAVLCGRWPGLSLGLLVCSR
LVLGFGESLCGTGAILWGIGRVGTSNNARVISWNGIATYGALAVGAPLGVAIERTVGFAA
LGILVILLAALGFYLARPMASVPIVHGERMSYRSVFTRVLPHGIGLALGSAGFGSIATFI
TLFYAAKQWPNAALSLTVFGTLFIGARLLFANTIKTYGGFRVAIVSFSFECVGLLMLWLA
PEPHIALAGAALTGFGFALVFPALGVEAVGLVPPASRGAALSAYSVFLDLSLGITGPLAG
YIAGEFGYGSVFLFAAIAAAAAVGLSGFLYLRDVKVGKMPAAL