Protein Info for H281DRAFT_04736 in Paraburkholderia bryophila 376MFSha3.1

Annotation: Alkyl hydroperoxide reductase subunit AhpC (peroxiredoxin)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 212 PF00578: AhpC-TSA" amino acids 6 to 135 (130 residues), 111.8 bits, see alignment E=3.2e-36 PF08534: Redoxin" amino acids 6 to 149 (144 residues), 55.8 bits, see alignment E=7e-19 PF10417: 1-cysPrx_C" amino acids 156 to 190 (35 residues), 38.1 bits, see alignment 1.7e-13

Best Hits

Swiss-Prot: 60% identical to PRDXL_DICDI: 1-Cys peroxiredoxin (DDB_G0282517) from Dictyostelium discoideum

KEGG orthology group: None (inferred from 99% identity to bgf:BC1003_0497)

MetaCyc: 54% identical to peroxiredoxin-6 monomer (Homo sapiens)
RXN-20693 [EC: 1.11.1.27]

Predicted SEED Role

"Alkyl hydroperoxide reductase subunit C-like protein" in subsystem Oxidative stress or Rubrerythrin or Thioredoxin-disulfide reductase

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.11.1.27

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5M9I5 at UniProt or InterPro

Protein Sequence (212 amino acids)

>H281DRAFT_04736 Alkyl hydroperoxide reductase subunit AhpC (peroxiredoxin) (Paraburkholderia bryophila 376MFSha3.1)
MSLRLGDTAPDFEQESSIGRIKFHEWLGDSWGVLFSHPADFTPVCTTELGLTAKLAEEFE
KRNVKTIALSVDSAESHKEWIKDINETQAANVGFPILADGDRKVSELYDMIHPNANETLT
VRSLFIIDPKKKVRLIITYPASTGRNFDEVLRVIDSLQLTDSHSVATPGNWKQGDDVVIV
PSLKDEEVIKQKFPKGYKALRPYLRMTPQPNK