Protein Info for H281DRAFT_04728 in Paraburkholderia bryophila 376MFSha3.1

Annotation: type IV fimbrial biogenesis protein FimT

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02532: prepilin-type N-terminal cleavage/methylation domain
  • amino acids 12 to 34 (23 residues), 20.6 bits, see alignment (E = 1.5e-08)
• PF07963: N_methyl
  • amino acids 12 to 33 (22 residues), 28.5 bits, see alignment (E = 8e-11)
• PF12019: GspH
  • amino acids 50 to 173 (124 residues), 58.3 bits, E=1.1e-19

Best Hits

KEGG orthology group: K08084, type IV fimbrial biogenesis protein FimT (inferred from 88% identity to bgf:BC1003_0489)

Predicted SEED Role

"Tfp pilus assembly protein FimT"

Protein Sequence (186 amino acids)

>H281DRAFT_04728 type IV fimbrial biogenesis protein FimT (Paraburkholderia bryophila 376MFSha3.1)
MKQHAIAPPPCGGFTLVETLVVVALLAVVVLMATPSFVAWQVRDQVDARAKALVSTLGYA
RSEALRRGARVTVCRADAARHCLAAGQPCGTGPTDWSCGWAVLADRGGTLTLLRAHPSLR
SVSIVGTQTNLTFTPPAGQLIGTFRSFDIAPRAPSKATQGDKWRRCIRIAAGGRTRIAEG
ACGAAS