Protein Info for H281DRAFT_04723 in Paraburkholderia bryophila 376MFSha3.1

Annotation: (3S)-malyl-CoA thioesterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 159 TIGR02799: tol-pal system-associated acyl-CoA thioesterase" amino acids 17 to 141 (125 residues), 165.1 bits, see alignment E=8.3e-53 TIGR00051: acyl-CoA thioester hydrolase, YbgC/YbaW family" amino acids 21 to 136 (116 residues), 104 bits, see alignment E=6.3e-34 PF13279: 4HBT_2" amino acids 26 to 143 (118 residues), 70.5 bits, see alignment E=1.8e-23 PF03061: 4HBT" amino acids 31 to 115 (85 residues), 64.6 bits, see alignment E=8.7e-22

Best Hits

KEGG orthology group: K07107, acyl-CoA thioester hydrolase [EC: 3.1.2.-] (inferred from 91% identity to bug:BC1001_0473)

Predicted SEED Role

"4-hydroxybenzoyl-CoA thioesterase family active site" in subsystem Ton and Tol transport systems

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.2.-

Use Curated BLAST to search for 3.1.2.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MA59 at UniProt or InterPro

Protein Sequence (159 amino acids)

>H281DRAFT_04723 (3S)-malyl-CoA thioesterase (Paraburkholderia bryophila 376MFSha3.1)
MRRMNMTTSQPGTEIGHSWGIRVYYEDTDAGGIVFYANYLKFFERARTEWLRACGIDQNR
LADETGAIFIVRSTAVDYRAPARLDDVVKVVSRIERLGRASVDFAQEAWRDGTLLATGSI
RVGCVERTALRPAAIPPQVLAALRRGPGVRDGGVSTNAC