Protein Info for H281DRAFT_04721 in Paraburkholderia bryophila 376MFSha3.1

Annotation: Cell division and transport-associated protein TolR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 148 transmembrane" amino acids 21 to 44 (24 residues), see Phobius details PF02472: ExbD" amino acids 16 to 146 (131 residues), 102.9 bits, see alignment E=7.1e-34 TIGR02801: protein TolR" amino acids 18 to 145 (128 residues), 140.5 bits, see alignment E=2.3e-45

Best Hits

KEGG orthology group: K03560, biopolymer transport protein TolR (inferred from 99% identity to bgf:BC1003_0483)

Predicted SEED Role

"Tol biopolymer transport system, TolR protein" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5M7U3 at UniProt or InterPro

Protein Sequence (148 amino acids)

>H281DRAFT_04721 Cell division and transport-associated protein TolR (Paraburkholderia bryophila 376MFSha3.1)
MAGSRSSSMRGGRSRRAMSDINVVPYIDVMLVLLVIFMVTAPLVAPSIVNLPTVGGAAPQ
QQTPPVIVNIRADGNMSVKYKDDSGAQQQEDMTKAGLNGFIADRAQSHPDQPVVIAADKT
VKYEAVMNVMSELKARGVKRVGLLVKSQ