Protein Info for H281DRAFT_04720 in Paraburkholderia bryophila 376MFSha3.1

Annotation: Cell division and transport-associated protein TolA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 342 transmembrane" amino acids 21 to 40 (20 residues), see Phobius details TIGR02794: protein TolA" amino acids 20 to 340 (321 residues), 150.3 bits, see alignment E=8.7e-48 PF13103: TonB_2" amino acids 257 to 337 (81 residues), 58.7 bits, see alignment E=2.6e-20 TIGR01352: TonB family C-terminal domain" amino acids 283 to 338 (56 residues), 34.2 bits, see alignment E=2.5e-12

Best Hits

KEGG orthology group: K03646, colicin import membrane protein (inferred from 89% identity to bug:BC1001_0470)

Predicted SEED Role

"TolA protein" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (342 amino acids)

>H281DRAFT_04720 Cell division and transport-associated protein TolA (Paraburkholderia bryophila 376MFSha3.1)
MIRKNTDYPLQPPRERGTGRAFAFALVMHALLGFFLYHGIQWQNSTPEGAEAELWTEVPD
TAIPRVAPPPPAPVVPAPPVADEQAEIALQEKKRKQQEAARQAQLAEQQRQEKLQAQQEA
EAKRQQQLAEQAAQLAAQKAAAAKQKQQQQQAEKLKQQQLAEQQKQQQLKEQQQEKQQEQ
QKQAEAEAQKKADAQKAAKAKAQAAQAEAAAQAKKVDAERRARLAQMQGMAGPPGSTGNG
LGKSGTGSGSGGNAASPGYADKVRRVVRPNISWGGETEGLETVIAVRCSPTGTLLSATIA
HSSGNSAWDDAALRAVQRSDPMPQDIDGKTPASFRITLRPAG