Protein Info for H281DRAFT_04647 in Paraburkholderia bryophila 376MFSha3.1

Annotation: D-alpha,beta-D-heptose 1,7-bisphosphate phosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01662: HAD hydrolase, family IIIA
  • amino acids 5 to 146 (142 residues), 121.3 bits, E=3.2e-39
• TIGR01656: histidinol-phosphate phosphatase domain
  • amino acids 6 to 144 (139 residues), 153.7 bits, E=3.3e-49
• PF08645: PNK3P
  • amino acids 9 to 131 (123 residues), 41.2 bits, E=3e-14
• PF00702: Hydrolase
  • amino acids 14 to 141 (128 residues), 46.4 bits, E=1.2e-15
• PF13419: HAD_2
  • amino acids 96 to 144 (49 residues), 25.1 bits, E=3.5e-09
• PF13242: Hydrolase_like
  • amino acids 102 to 172 (71 residues), 47.7 bits, E=2.4e-16

Best Hits

Swiss-Prot: 60% identical to GMHBB_BORBR: D-glycero-beta-D-manno-heptose-1,7-bisphosphate 7-phosphatase (BB4091) from Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)

KEGG orthology group: K03273, D-glycero-D-manno-heptose 1,7-bisphosphate phosphatase [EC: 3.1.3.-] (inferred from 97% identity to bug:BC1001_0396)

Predicted SEED Role

"D-glycero-D-manno-heptose 1,7-bisphosphate phosphatase (EC 3.1.1.-); Histidinol-phosphatase (EC 3.1.3.15)" (EC 3.1.1.-, EC 3.1.3.15)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (44/46 steps found)
• L-histidine biosynthesis (10/10 steps found)

KEGG Metabolic Maps

• 2,4-Dichlorobenzoate degradation
• Alkaloid biosynthesis II
• Aminosugars metabolism
• Ascorbate and aldarate metabolism
• Biosynthesis of alkaloids derived from histidine and purine
• Ether lipid metabolism
• Fructose and mannose metabolism
• Glycerophospholipid metabolism
• Histidine metabolism
• Lipopolysaccharide biosynthesis
• Nicotinate and nicotinamide metabolism
• Retinol metabolism
• Riboflavin metabolism
• Sphingolipid metabolism
• Thiamine metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.1.1.-, 3.1.3.-

Use Curated BLAST to search for 3.1.1.- or 3.1.3.- or 3.1.3.15

Sequence Analysis Tools

See A0A2Z5M876 at UniProt or InterPro

Protein Sequence (184 amino acids)

>H281DRAFT_04647 D-alpha,beta-D-heptose 1,7-bisphosphate phosphatase (Paraburkholderia bryophila 376MFSha3.1)
MPTKKVVILDRDGVINADSDAFIKSPDEWVALPGSLEAIARLSQAGYRVAIATNQSGIGR
GLFDMNALNAMHLKMHRMAASVGGRIDAVFFCPHTAEDHCECRKPKPGMLKMINERFEVD
PENTPVVGDAMRDLQAGAALGHPVHLVLTGKGRKTLTAGGLPDGTVVHDDLRAFVLDFLA
DAQE