Protein Info for H281DRAFT_04616 in Paraburkholderia bryophila 376MFSha3.1

Annotation: 2-octaprenylphenol hydroxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 525 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 501 to 523 (23 residues), see Phobius details TIGR01982: 2-polyprenylphenol 6-hydroxylase" amino acids 3 to 441 (439 residues), 544 bits, see alignment E=1.1e-167 PF03109: ABC1" amino acids 87 to 340 (254 residues), 238.9 bits, see alignment E=2.4e-75

Best Hits

Swiss-Prot: 98% identical to UBIB_PARXL: Probable protein kinase UbiB (ubiB) from Paraburkholderia xenovorans (strain LB400)

KEGG orthology group: K03688, ubiquinone biosynthesis protein (inferred from 99% identity to bug:BC1001_0367)

Predicted SEED Role

"Ubiquinone biosynthesis monooxygenase UbiB" in subsystem Ubiquinone Biosynthesis

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5M8E7 at UniProt or InterPro

Protein Sequence (525 amino acids)

>H281DRAFT_04616 2-octaprenylphenol hydroxylase (Paraburkholderia bryophila 376MFSha3.1)
MRFLRFLKIFFTVIRFGLDEMMLGRVNDRRVRMLLRITTIGRKFDAPPGVRLRLALESLG
PIFVKFGQVLSTRRDLLPVDIANELAKLQDQVPPFDSAVAIGLVEKSLGAPVDVLFDDFE
RVPVASASIAQVHFATVKAGQHAGKAVAVKVLRPNMLPVIDSDLALLRDIAVWAERLWAD
GKRLKPREVVAEFDKYLHDELDLMREAANGSQLRRNFAGLDLLLVPEMYWEFCTPTVLVM
ERMVGVPISQVDTLRAAGVDIPKLAREGVEIFFTQVFRDGFFHADMHPGNIQVSLDPAHF
GRYIALDFGIIGALSDFDKNYLAQNFLAFFKRDYHRVATLHLESGWVPPTTRVEELESAI
RAVCEPYFDRALKDISLGQVLMRLFSTSRRFNVEIQPQLVLLQKTMLNVEGLGRSLDPEL
DLWKTAKPYLERWMNEQIGLRGWYERLKIEAPQWSKTLPQLPRLIHHVLAERHDHGRVGN
DDMIRQILLEQKRTNRLLQGLLLFGVAVGVGAALARVVLALAYGS