Protein Info for H281DRAFT_04613 in Paraburkholderia bryophila 376MFSha3.1

Annotation: demethylmenaquinone methyltransferase /2-octaprenyl-6-methoxy-1,4-benzoquinone methylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01209: Ubie_methyltran
  • amino acids 15 to 242 (228 residues), 288 bits, E=1.5e-89
• TIGR01934: ubiquinone/menaquinone biosynthesis methyltransferase
  • amino acids 20 to 242 (223 residues), 246.2 bits, E=1.2e-77
• PF13489: Methyltransf_23
  • amino acids 57 to 225 (169 residues), 38.5 bits, E=3e-13
• PF13847: Methyltransf_31
  • amino acids 58 to 221 (164 residues), 64.2 bits, E=3.7e-21
• PF13649: Methyltransf_25
  • amino acids 62 to 157 (96 residues), 70.6 bits, E=4.5e-23
• PF08242: Methyltransf_12
  • amino acids 63 to 159 (97 residues), 41 bits, E=8.1e-14
• PF08241: Methyltransf_11
  • amino acids 63 to 160 (98 residues), 68.9 bits, E=1.4e-22

Best Hits

Swiss-Prot: 98% identical to UBIE_PARPJ: Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE (ubiE) from Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)

KEGG orthology group: K03183, ubiquinone/menaquinone biosynthesis methyltransferase [EC: 2.1.1.- 2.1.1.163] (inferred from 96% identity to bge:BC1002_0369)

MetaCyc: 63% identical to bifunctional 2-octaprenyl-6-methoxy-1,4-benzoquinol methylase and demethylmenaquinone methyltransferase (Escherichia coli K-12 substr. MG1655)
2-OCTAPRENYL-METHOXY-BENZOQ-METH-RXN [EC: 2.1.1.201]; ADOMET-DMK-METHYLTRANSFER-RXN [EC: 2.1.1.201, 2.1.1.163]

Predicted SEED Role

No annotation

MetaCyc Pathways

• superpathway of ubiquinol-8 biosynthesis (early decarboxylation) (10/12 steps found)
• superpathway of chorismate metabolism (43/59 steps found)
• menaquinol-4 biosynthesis I (1/1 steps found)
• menaquinol-6 biosynthesis (1/1 steps found)
• menaquinol-8 biosynthesis (1/1 steps found)
• menaquinol-9 biosynthesis (1/1 steps found)
• ubiquinol-8 biosynthesis (early decarboxylation) (6/8 steps found)
• menaquinol-10 biosynthesis (1/2 steps found)
• menaquinol-11 biosynthesis (1/2 steps found)
• menaquinol-12 biosynthesis (1/2 steps found)
• menaquinol-13 biosynthesis (1/2 steps found)
• menaquinol-7 biosynthesis (1/2 steps found)
• ubiquinol-8 biosynthesis (late decarboxylation) (4/9 steps found)
• ubiquinol-9 biosynthesis (early decarboxylation) (3/8 steps found)
• ubiquinol-9 biosynthesis (late decarboxylation) (3/8 steps found)
• ubiquinol-10 biosynthesis (early decarboxylation) (2/8 steps found)
• ubiquinol-6 biosynthesis (late decarboxylation) (2/8 steps found)
• ubiquinol-7 biosynthesis (early decarboxylation) (2/8 steps found)
• ubiquinol-7 biosynthesis (late decarboxylation) (2/8 steps found)
• superpathway of menaquinol-8 biosynthesis I (3/10 steps found)
• superpathway of menaquinol-8 biosynthesis III (2/9 steps found)
• ubiquinol-10 biosynthesis (late decarboxylation) (2/9 steps found)
• ubiquinol-6 biosynthesis from 4-aminobenzoate (yeast) (2/9 steps found)
• superpathway of ubiquinol-6 biosynthesis (late decarboxylation) (3/11 steps found)
• superpathway of menaquinol-10 biosynthesis (2/10 steps found)
• superpathway of menaquinol-11 biosynthesis (2/10 steps found)
• superpathway of menaquinol-12 biosynthesis (2/10 steps found)
• superpathway of menaquinol-13 biosynthesis (2/10 steps found)
• superpathway of menaquinol-6 biosynthesis (2/10 steps found)
• superpathway of menaquinol-7 biosynthesis (2/10 steps found)
• superpathway of menaquinol-8 biosynthesis II (2/10 steps found)
• superpathway of menaquinol-9 biosynthesis (2/10 steps found)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.- or 2.1.1.163 or 2.1.1.201

Sequence Analysis Tools

See A0A2Z5M7L8 at UniProt or InterPro

Protein Sequence (243 amino acids)

>H281DRAFT_04613 demethylmenaquinone methyltransferase /2-octaprenyl-6-methoxy-1,4-benzoquinone methylase (Paraburkholderia bryophila 376MFSha3.1)
MSKTHFGFQSVDEQEKAQKVAGVFHSVAANYDLMNDLMSGGLHRAWKMFTIAQANVRPGY
KVLDIAGGTGDLSKAFAKQAGETGEVWHTDINESMLRVGRDRLLDKGVITPALLCDAEKI
PFPDNYFDVVTVAFGLRNMTHKDVALAEMRRVLKPAGRLLVLEFSKVWDPLKKAYDVYSF
KVLPWLGERFAKDAESYRYLAESIRMHPDQETLKTMMEQAGLDGVKYYNLSAGVVALHVG
TKY